AntibioticMech

N-(4-{[(1H-benzotriazol-1-yl)acetyl][(thiophen-3-yl)methyl]amino}phenyl)propanamide

CHEBI:149680 ·resolve ·ANTIVIRAL ·EXACT SEEDED

A member of the class of benzotriazoles that is 1H-benzotriazole which is substituted by a 2-oxo-2-{(4-propanamidophenyl)[(thiophen-3-yl)methyl]amino}ethyl group at position 1. It is a 3C-like protease inhibitor of SARS-CoV and bat coronavirus HKU4. — ChEBI

Machine-generated and unreviewed. Identity, structure and cross-references come straight from ChEBI's and CARD's own data; no curator has signed off on this record yet.

Classification

Strictly broader compounds or drug classes this molecule belongs to.

Chemical structure

Computed structure properties
Molecular formulaC22H21N5O2S
Charge0
Average mass419.51 Da
Monoisotopic mass419.1416 Da
SourceChEBI
InChIKeyTWIVXCFEBRGEKY-UHFFFAOYSA-N

SMILES

CCC(=O)Nc1ccc(N(Cc2ccsc2)C(=O)Cn2nnc3ccccc32)cc1

InChI

InChI=1S/C22H21N5O2S/c1-2-21(28)23-17-7-9-18(10-8-17)26(13-16-11-12-30-15-16)22(29)14-27-20-6-4-3-5-19(20)24-25-27/h3-12,15H,2,13-14H2,1H3,(H,23,28)

Cross-references

Equivalent identifiers for this same structure in other resources.

Activity roles

Every antimicrobial role a source asserts for this compound — the unreduced evidence behind its antimicrobial_class.

Source concepts

Every upstream concept that resolved to this record. The merge is the product: this is what shows ChEBI and CARD are describing the same structure.

Upstream concepts merged into this record
SourceNative IDLabelMinted CURIEVersion
CHEBI CHEBI:149680 N-(4-{[(1H-benzotriazol-1-yl)acetyl][(thiophen-3-yl)methyl]amino}phenyl)propanamide antibioticmech:chebi-0454fe0cfb 2026-08-30

Molecular targets

The molecular entity or process this compound acts on. Each target carries evidence — this is a mechanistic claim, not a classification.

Replicase polyprotein 1ab VIRAL_PROTEIN MEASURED_TARGET_ASSOCIATION

BindingDB quantitative measurement in the named target organism; source assay descriptions and identifiers are retained per measurement. Evidence status: PRIMARY_EVIDENCE. Source: BINDINGDB 2026-09 (retrieved 2026-08-31).

Severe acute respiratory syndrome coronavirus 2 NCBITaxon:2697049

Quantitative measurements
TypeReported valueAssayBindingDB IDsReference
IC50 12600 nM RapidFire MPro inhibition assay
The assay was performed according to the published procedure. Briefly, compounds were seeded into assay-ready plates (Greiner 384PP, cat# 781280) using an ECHO 650T dispenser and DMSO was back-filled for a uniform concentration in assay plates (DMSO concentration < 1%, final volume = 500 nL.). A 15 uM enzyme stock solution is prepared in 20 mM HEPES, pH 7.5 and 300 mM NaCl, and subsequently diluted to a working solution of 300 nM Mpro in assay buffer (20 mM HEPES, pH 7.5 and 50 mM NaCl) before the addition of 25 uL to each well using a Multidrop Combi (Thermo Scientific). After a quick centrifugation step (1000 rpm, 15 s) the plate is incubated for 15 min at room temperature. The reaction is initiated with the addition of 25 uL of 4 uM 11-mer (TSAVLQSGFRK-NH2, initially custom synthesized by the Schofield group, GLBiochem, used until March 2021), or 10 uM 37-mer (ALNDFSNSGSDVLYQPPQTSITSAVLQSGFRKMAFPS-NH2, GLBiochem, used after March 2021), dissolved in assay buffer. After centrifugation (1000 rpm, 14 s) the reaction is incubated for 10 min (11-mer) or 5 min (37-mer) at room temperature before quenching with 10 % formic acid. The reactions are analysed with MS using RapidFire (RF) 365 high-throughput sampling robot (Agilent) connected to an iFunnel Agilent 6550 accurate mass quadrupole time-of-flight (Q-TOF) mass spectrometer using electrospray. All compounds are triaged by testing the % inhibition at 5 and 50 uM final concentration. Dose response curves uses an 11-point range of 100--0.0017 uM inhibitor concentrations. RapidFire integrator software (Agilent) was used to extract the charged states from the total ion chromatogram data followed by peak integration. For the 11-mer peptide the m/z (+1) charge states of both the substrate (1191.67 Da) and cleaved N-terminal product TSAVLQ (617.34 Da) were used and the 37-mer peptide the m/z (+2) charge states of the substrate (3960.94 Da) and m/z (+1) of the cleaved C-terminal product SGFRKMAFPS (1125.57 Da). Percentage conversion (product peak integral / (product peak integral + substrate peak integral))*100) and percentage inhibitions were calculated and normalised against DMSO control with deduction of any background signal in Microsoft Excel. IC50s were calculated using Levenberg Marquardt algorithm used to fit a restrained Hill equation to the dose-response data with both GraphPad PRISM and CDD.		 RSID 1033211
assay 9877_1
monomer 429461		 DOI:10.1101/2020.10.29.339317
IC50 1630 nM Fluorescence MPro inhibition assay
Compounds were seeded into assay-ready plates (Greiner 384 low volume, cat 784900) using an Echo 555 acoustic dispenser, and DMSO was back-filled for a uniform concentration in assay plates (DMSO concentration maximum 1%) Screening assays were performed in duplicate at 20uM and 50uM. Hits of greater than 50% inhibition at 50uM were confirmed by dose response assays. Dose response assays were performed in 12 point dilutions of 2-fold, typically beginning at 100uM. Highly active compounds were repeated in a similar fashion at lower concentrations beginning at 10uM or 1uM. Reagents for Mpro assay were dispensed into the assay plate in 10ul volumes for a final volume of 20uL. Final reaction concentrations were 20mM HEPES pH7.3, 1.0mM TCEP, 50mM NaCl, 0.01% Tween-20, 10% glycerol, 5nM Mpro, 375nM fluorogenic peptide substrate ([5-FAM]-AVLQSGFR-[Lys(Dabcyl)]-K-amide). Mpro was pre-incubated for 15 minutes at room temperature with compound before addition of substrate and a further 30 minute incubation. Protease reaction was measured in a BMG Pherastar FS with a 480/520 ex/em filter set. Raw data was mapped and normalized to high (Protease with DMSO) and low (No Protease) controls using Genedata Screener software. Normalized data was then uploaded to CDD Vault (Collaborative Drug Discovery). Dose response curves were generated for IC50 using nonlinear regression with the Levenberg Marquardt algorithm with minimum inhibition = 0% and maximum inhibition = 100%.		 RSID 1033212
assay 9877_2
monomer 429461		 DOI:10.1101/2020.10.29.339317
IC50 1630 nM Fluorescence Mpro inhibition assay (S1)
Compounds were seeded into assay-ready plates (Greiner 384 low volume, cat. no. 784900) using an Echo 555 acoustic dispenser, and dimethyl sulfoxide (DMSO) was back-filled for a uniform concentration in assay plates (DMSO concentration maximum 1%) Screening assays were performed in duplicate at 20 μM and 50 μM. Hits of greater than 50% inhibition at 50 μM were confirmed by dose response assays. Dose response assays were performed in 12-point dilutions of twofold, typically beginning at 100 μM. Highly active compounds were repeated in a similar fashion at lower concentrations beginning at 10 μM or 1 μM. Reagents for Mpro assay were dispensed into the assay plate in 10 μl volumes for a final volume of 20 μl.Final reaction concentrations were 20 mM HEPES pH 7.3, 1.0 mM TCEP, 50 mM NaCl, 0.01% Tween-20, 10% glycerol, 5 nM Mpro, 375 nM fluorogenic peptide substrate ([5-FAM]-AVLQSGFR-[Lys(Dabcyl)]-K-amide). Mpro was pre-incubated for 15 min at room temperature with compound before addition of substrate and a further 30-min incubation. Protease reaction was measured in a BMG Pherastar FS with a 480/520 excitation/emission filter set. Raw data were mapped and normalized to high (Protease with DMSO) and low (No Protease) controls using Genedata Screener software. Normalized data were then uploaded to CDD Vault (Collaborative Drug Discovery). Dose response curves were generated for IC50 using nonlinear regression with the Levenberg Marquardt algorithm with minimum inhibition = 0% and maximum inhibition = 100%.The assay was calibrated at different enzyme concentrations to confirm linearity and response of protease activity, as well as optimization of buffer components for most stable and reproducible assay conditions. Substrate concentration was chosen after titration to minimize saturation of signal in the plate reader while obtaining a satisfactory and robust dynamic range of typically five- to sixfold over control without enzyme. We used low substrate concentrations of the bright FRET peptide to avoid inner filter effect (60) and to bias toward detection of competitive inhibitors (61). As positive control, under our assay condition, nirmatrelvir has IC50 of 2.6 nM.		 RSID 1334692
assay 11549_3
monomer 429461		 PMID:37943932
Organism-specific examples
ProteinGeneOrganismEntry
Replicase polyprotein 1ab UniProtKB:P0DTD1 — Severe acute respiratory syndrome coronavirus 2 REVIEWED

Replicase polyprotein 1ab VIRAL_PROTEIN MEASURED_TARGET_ASSOCIATION

BindingDB quantitative measurement in the named target organism; source assay descriptions and identifiers are retained per measurement. Evidence status: PRIMARY_EVIDENCE. Source: BINDINGDB 2026-09 (retrieved 2026-08-31).

Severe acute respiratory syndrome coronavirus NCBITaxon:2901879

Quantitative measurements
TypeReported valueAssayBindingDB IDsReference
IC50 2900 nM No assay is provided
This is a review article.		 RSID 868895
assay 8918_1
monomer 429461		 PMID:32852058
IC50 2900 nM Various Assay
This is a review article. Please point to the original journal.		 RSID 1073859
assay 10079_1
monomer 429461		 PMID:34798775
Organism-specific examples
ProteinGeneOrganismEntry
Replicase polyprotein 1ab UniProtKB:P0C6X7 — Severe acute respiratory syndrome coronavirus REVIEWED

Mechanism summary

Mode of action
VIRAL_PROTEASE_INHIBITION microbial target — Assigned from ChEBI role CHEBI:147285 (EC 3.4.22.69 (SARS coronavirus main proteinase) inhibitor). ChEBI asserts the role on the compound. The role names a target specific to the microbe or virus — see mode_of_action_target_scope. Not a curator's mechanistic review.

Curation history

  1. SEEDED_FROM_SOURCES 2026-08-30 · seed_from_sources

    Seeded from data/raw/ inventories (CHEBI)

  2. RESEEDED_FROM_SOURCES 2026-08-30 · seed_from_sources

    Re-seeded from updated data/raw/ inventories

  3. RESEEDED_FROM_SOURCES 2026-08-30 · seed_from_sources

    Re-seeded from updated data/raw/ inventories

  4. RESEEDED_FROM_SOURCES 2026-08-31 · seed_from_sources

    Re-seeded from updated data/raw/ inventories

Provenance

Seeded by scripts/seed_from_sources.py from the committed inventories in data/raw/. View the record.