mupirocin
CHEBI:7025 EXACT SEEDED antibacterial
What these status tags mean
Curation status describes a workflow state. SEEDED means the record entered through the source-seeding workflow; it does not imply that no later curation occurred. PROPOSED marks an addition awaiting review; REVIEWED records curator sign-off on identity, structure, filing class and producer claims; DEPRECATED retains a superseded or out-of-scope record. These are workflow decisions, not independently verified human review. Agent-assisted contributions may appear in the record history.
Grounding describes the identifier mapping: EXACT uses an ontology identity asserted by the source; MINTED keeps a local identifier when no defensible ontology identity is available; REVIEW_NEEDED flags an exact structure whose ontology identity needs adjudication. The grounding note retains any unresolved alternatives. These tags do not establish the strength of producer or activity evidence.
An α,β-unsaturated ester resulting from the formal condensation of the alcoholic hydroxy group of 9-hydroxynonanoic acid with the carboxy group of (2E)-4-[(2S)-tetrahydro-2H-pyran-2-yl]-3-methylbut-2-enoic acid in which the tetrahydropyranyl ring is substituted at positions 3 and 4 by hydroxy groups and at position 5 by a {(2S,3S)-3-[(2S,3S)-3-hydroxybutan-2-yl]oxiran-2-yl}methyl group. Originally isolated from the Gram-negative bacterium Pseudomonas fluorescens, it is used as a topical antibiotic for the treatment of Gram-positive bacterial infections.
Structure
| Standard InChIKey | MINDHVHHQZYEEK-HBBNESRFSA-N |
|---|---|
| SMILES | C[C@H](O)[C@H](C)[C@@H]1O[C@H]1C[C@H]1CO[C@@H](C\C(C)=C\C(=O)OCCCCCCCCC(O)=O)[C@H](O)[C@@H]1O |
| Stereochemistry | fully defined |
| Cross-references | npatlas:NPA06173 |
Filing pathway
Polyketides — computed by NPClassifier npclassifier.gnps2.org@2026-09-07, which is why it is pinned rather than recomputed. The gene cluster's asserted class is pks, from MIBiG.
Producer organisms 1
A claim that this taxon makes the compound. The basis says what the evidence addressed — a knockout and a database assertion are not the same claim.
| Taxon | Basis | Cluster | Evidence |
|---|---|---|---|
| Pseudomonas fluorescens NCBITaxon:294 |
BGC_CHARACTERIZED | mibig:BGC0000182 | PMID:11495990 |
Occurrences 5
Somebody found the compound in this organism and cited it. That is not a claim that the organism makes it, and nothing here promotes one to the other.
| Taxon | Source | Reference |
|---|---|---|
| Pseudomonas fluorescens NCBITaxon:294 |
LOTUS | DOI:10.1039/C39740000847 |
| Pseudomonas fluorescens NCBITaxon:294 |
LOTUS | DOI:10.1039/P19890000207 |
| Pseudomonas fluorescens NCBITaxon:294 |
LOTUS | DOI:10.1099/00221287-147-8-2127 |
| Pseudomonas fluorescens NCBITaxon:294 |
LOTUS | DOI:10.1111/J.1574-6968.1989.TB03082.X |
| Pseudomonas fluorescens NCBITaxon:294 |
LOTUS | DOI:10.1128/AAC.27.4.495 |
Biosynthetic gene clusters 1
| Accession | Host | Locus evidence | Genome |
|---|---|---|---|
| mibig:BGC0000182 | Pseudomonas fluorescens NCBITaxon:294 |
CLUSTER_DEMONSTRATED | genbank:AF318063.3 |
A locus claim and a taxon claim are different questions. Heterologous expression settles the first and leaves the second where the isolation report left it.
Mechanism & Biosynthesis Overview
Causal graph — biosynthesis 13 nodes, 18 edges
Separate MmpF-KS,MacpA and MacpB genetic phenotypes. Source-assigned products remain ungrounded; no biosynthetic ordering from gene order. Native reference, engineered preparation and study readout remain distinct. Partial primary-main-text curation, not complete pathway reconstitution or full-record sign-off. The exact PAA owner is not the clinical mupirocin mixture.
| Subject | Predicate | Object | Notes | Evidence |
|---|---|---|---|---|
| Native mupirocin locus in NCIMB 10586 | encodes_native_reference | Native MmpF sequence reference | AF318063.3 CDS 63348..65585(+),1-based inclusive; AAM12934.1,745 aa. CDS-aware table-11 translation exactly matches original GenPept and current UniProt. Native source is Pseudomonas fluorescens NCIMB 10586,taxon294. This is not full engineered-proteoform or laboratory-stock identity. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| Native mupirocin locus in NCIMB 10586 | encodes_native_reference | Native MacpA sequence reference | AF318063.3 CDS 41870..42175(+),1-based inclusive; AAM12915.1,101 aa. CDS-aware table-11 translation exactly matches original GenPept and current UniProt. Native source is Pseudomonas fluorescens NCIMB 10586,taxon294. This is not full engineered-proteoform or laboratory-stock identity. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| Native mupirocin locus in NCIMB 10586 | encodes_native_reference | Native MacpB sequence reference | AF318063.3 CDS 44062..44313(+),1-based inclusive; AAM12918.1,83 aa. CDS-aware table-11 translation exactly matches original GenPept and current UniProt. Native source is Pseudomonas fluorescens NCIMB 10586,taxon294. This is not full engineered-proteoform or laboratory-stock identity. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| Reported mmpF KS-domain deletion allele | affects_coding_locus_of | Native MmpF sequence reference | The mmpF intervention targets its KS region, not a demonstrated deletion of the entire KS/AT-like protein. Complete junction/residual sequences remain unverified. | DOI:10.1002/anie.202212393
|
| Reported mmpF KS-domain deletion allele | was_introduced_in | Study P. fluorescens mmpF mutant culture | Native-producer genetic intervention, not a purified-protein assay. Complete mutant stock identity, complementation and all polar effects are not established here. | DOI:10.1002/anie.202212393
|
| Study P. fluorescens mmpF mutant culture | lacked_detected_production_of | Source-assigned pseudomonic acid A | Bounded culture-extract report; no universal zero, detection limit, numerical titre or replicate-level estimate. This endpoint does not by itself assign a catalytic step. | DOI:10.1002/anie.202212393
|
| Study P. fluorescens mmpF mutant culture | yielded_source_assigned_metabolite | Source-assigned mupirocin H | Source-assigned extract products, not direct substrates or products of the missing protein. | DOI:10.1002/anie.202212393
|
| Study P. fluorescens mmpF mutant culture | yielded_source_assigned_metabolite | Source-assigned mupiric acid | Source-assigned extract products, not direct substrates or products of the missing protein. | DOI:10.1002/anie.202212393
|
| Reported macpA deletion allele | affects_coding_locus_of | Native MacpA sequence reference | Reported gene deletion; exact endpoints and residual-protein sequence remain unverified. | DOI:10.1002/anie.202212393
|
| Reported macpA deletion allele | was_introduced_in | Study P. fluorescens macpA mutant culture | Native-producer genetic intervention, not a purified-protein assay. Complete mutant stock identity, complementation and all polar effects are not established here. | DOI:10.1002/anie.202212393
|
| Study P. fluorescens macpA mutant culture | lacked_detected_production_of | Source-assigned pseudomonic acid A | Bounded culture-extract report; no universal zero, detection limit, numerical titre or replicate-level estimate. This endpoint does not by itself assign a catalytic step. | DOI:10.1002/anie.202212393
|
| Study P. fluorescens macpA mutant culture | yielded_source_assigned_metabolite | Source-assigned mupirocin H | Source-assigned extract products, not direct substrates or products of the missing protein. | DOI:10.1002/anie.202212393
|
| Study P. fluorescens macpA mutant culture | yielded_source_assigned_metabolite | Source-assigned mupiric acid | Source-assigned extract products, not direct substrates or products of the missing protein. | DOI:10.1002/anie.202212393
|
| Reported macpB deletion allele | affects_coding_locus_of | Native MacpB sequence reference | Reported gene deletion; exact endpoints and residual-protein sequence remain unverified. | DOI:10.1002/anie.202212393
|
| Reported macpB deletion allele | was_introduced_in | Study P. fluorescens macpB mutant culture | Native-producer genetic intervention, not a purified-protein assay. Complete mutant stock identity, complementation and all polar effects are not established here. | DOI:10.1002/anie.202212393
|
| Study P. fluorescens macpB mutant culture | lacked_detected_production_of | Source-assigned pseudomonic acid A | Bounded culture-extract report; no universal zero, detection limit, numerical titre or replicate-level estimate. This endpoint does not by itself assign a catalytic step. | DOI:10.1002/anie.202212393
|
| Study P. fluorescens macpB mutant culture | yielded_source_assigned_metabolite | Source-assigned mupirocin H | Source-assigned extract products, not direct substrates or products of the missing protein. The main text describes these products as trace amounts for this mutant. | DOI:10.1002/anie.202212393
|
| Study P. fluorescens macpB mutant culture | yielded_source_assigned_metabolite | Source-assigned mupiric acid | Source-assigned extract products, not direct substrates or products of the missing protein. The main text describes these products as trace amounts for this mutant. | DOI:10.1002/anie.202212393
|
Every edge carries its own citation; an uncited edge is refused by the corpus tests.
Causal graph — biosynthesis 27 nodes, 31 edges
NMR partner screening with native references separate from excised/isotope-labelled preparations. TacpB is a mixed-origin surrogate, not MacpB. Native reference, engineered preparation and study readout remain distinct. Partial primary-main-text curation, not complete pathway reconstitution or full-record sign-off. The exact PAA owner is not the clinical mupirocin mixture.
| Subject | Predicate | Object | Notes | Evidence |
|---|---|---|---|---|
| Native mupirocin locus in NCIMB 10586 | encodes_native_reference | Native MmpF sequence reference | AF318063.3 CDS 63348..65585(+),1-based inclusive; AAM12934.1,745 aa. CDS-aware table-11 translation exactly matches original GenPept and current UniProt. Native source is Pseudomonas fluorescens NCIMB 10586,taxon294. This is not full engineered-proteoform or laboratory-stock identity. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| Native mupirocin locus in NCIMB 10586 | encodes_native_reference | Native MacpD sequence reference | AF318063.3 CDS 63031..63351(+),1-based inclusive; AAM12933.1,106 aa. CDS-aware table-11 translation exactly matches original GenPept and current UniProt. Native source is Pseudomonas fluorescens NCIMB 10586,taxon294. This is not full engineered-proteoform or laboratory-stock identity. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| Native mupirocin locus in NCIMB 10586 | encodes_native_reference | Native MacpA sequence reference | AF318063.3 CDS 41870..42175(+),1-based inclusive; AAM12915.1,101 aa. CDS-aware table-11 translation exactly matches original GenPept and current UniProt. Native source is Pseudomonas fluorescens NCIMB 10586,taxon294. This is not full engineered-proteoform or laboratory-stock identity. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| Native mupirocin locus in NCIMB 10586 | encodes_native_reference | Native MmpB sequence reference | AF318063.3 CDS 11325..17555(+),1-based inclusive; AAM12911.1,2076 aa. CDS-aware table-11 translation exactly matches original GenPept and current UniProt. Native source is Pseudomonas fluorescens NCIMB 10586,taxon294. This is not full engineered-proteoform or laboratory-stock identity. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| Native mupirocin locus in NCIMB 10586 | encodes_native_reference | Native MupB sequence reference | AF318063.3 CDS 10278..11183(+),1-based inclusive; AAM12910.1,301 aa. CDS-aware table-11 translation exactly matches original GenPept and current UniProt. Native source is Pseudomonas fluorescens NCIMB 10586,taxon294. This is not full engineered-proteoform or laboratory-stock identity. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| Native MmpF sequence reference | is_native_sequence_reference_for | Study purified MmpF preparation | Gene-matched reference, not complete fusion/insert or isotopic/proteoform identity. | DOI:10.1002/anie.202212393
|
| Native MacpD sequence reference | is_native_sequence_reference_for | Study 15N-labelled apo-MacpD preparation | Gene-matched reference, not complete fusion/insert or isotopic/proteoform identity. | DOI:10.1002/anie.202212393
|
| Native MacpA sequence reference | is_native_sequence_reference_for | Study 15N-labelled MacpA preparation | Gene-matched reference, not complete fusion/insert or isotopic/proteoform identity. | DOI:10.1002/anie.202212393
|
| Native MmpB sequence reference | is_native_sequence_reference_for | Study excised MmpB KS-domain preparation | Gene-matched reference, not complete fusion/insert or isotopic/proteoform identity. The assay uses an excised KS domain, not the full 2076-aa protein or its ACP tridomain. | DOI:10.1002/anie.202212393
|
| Native MupB sequence reference | is_native_sequence_reference_for | Study purified MupB preparation | Gene-matched reference, not complete fusion/insert or isotopic/proteoform identity. | DOI:10.1002/anie.202212393
|
| Thiomarinol native pTML1 locus | encodes_native_reference | Native TacpB sequence reference | FN689524.1 complement10748..11083,1-based inclusive; CBK62717.1,111aa,alias tacp13. CDS/GenPept/UniParc match; SANK73390,taxon747457,pTML1. Deleted F8J3F1 is not a live UniProt example; inactive archived RefSeq cross-references are not selected. | https://www.ncbi.nlm.nih.gov/nuccore/FN689524.1 |
| Native TacpB sequence reference | is_native_sequence_reference_for | Study 15N-labelled TacpB surrogate preparation | TacpB substitutes for MacpB in the labelled NMR experiment because labelled MacpB was insoluble in the reported minimal-media expression. This is not direct MacpB NMR data or proof that the native carrier proteins are functionally identical. | DOI:10.1002/anie.202212393
|
| Study 15N-labelled apo-MacpD preparation | was_tested_in | Study MacpD/MmpF NMR titration | Reported NMR titration, not a catalytic assay or direct native-producer experiment. No unverified dose, stoichiometry, equilibrium affinity or tag sequence adopted. | DOI:10.1002/anie.202212393
|
| Study purified MmpF preparation | was_tested_in | Study MacpD/MmpF NMR titration | Reported NMR titration, not a catalytic assay or direct native-producer experiment. No unverified dose, stoichiometry, equilibrium affinity or tag sequence adopted. | DOI:10.1002/anie.202212393
|
| Study MacpD/MmpF NMR titration | yielded_reported_readout | Reported MacpD line broadening | Qualitative NMR readout supports a possible interaction but not a stable native complex, substrate transfer or quantified affinity. | DOI:10.1002/anie.202212393
|
| Study 15N-labelled MacpA preparation | was_tested_in | Study MacpA/MmpF NMR titration | Reported NMR titration, not a catalytic assay or direct native-producer experiment. No unverified dose, stoichiometry, equilibrium affinity or tag sequence adopted. | DOI:10.1002/anie.202212393
|
| Study purified MmpF preparation | was_tested_in | Study MacpA/MmpF NMR titration | Reported NMR titration, not a catalytic assay or direct native-producer experiment. No unverified dose, stoichiometry, equilibrium affinity or tag sequence adopted. | DOI:10.1002/anie.202212393
|
| Study MacpA/MmpF NMR titration | yielded_reported_readout | Reported MacpA line broadening | Qualitative NMR readout supports a possible interaction but not a stable native complex, substrate transfer or quantified affinity. | DOI:10.1002/anie.202212393
|
| Study 15N-labelled TacpB surrogate preparation | was_tested_in | Study TacpB/MmpF NMR titration | Reported NMR titration, not a catalytic assay or direct native-producer experiment. No unverified dose, stoichiometry, equilibrium affinity or tag sequence adopted. | DOI:10.1002/anie.202212393
|
| Study purified MmpF preparation | was_tested_in | Study TacpB/MmpF NMR titration | Reported NMR titration, not a catalytic assay or direct native-producer experiment. No unverified dose, stoichiometry, equilibrium affinity or tag sequence adopted. | DOI:10.1002/anie.202212393
|
| Study TacpB/MmpF NMR titration | yielded_reported_readout | Reported TacpB NMR response | Qualitative NMR readout supports a possible interaction but not a stable native complex, substrate transfer or quantified affinity. The response is described as less pronounced than MacpA, not a quantitative affinity ranking. | DOI:10.1002/anie.202212393
|
| Study 15N-labelled apo-MacpD preparation | was_tested_in | Study MacpD/MmpB-KS NMR titration | Reported NMR titration, not a catalytic assay or direct native-producer experiment. No unverified dose, stoichiometry, equilibrium affinity or tag sequence adopted. | DOI:10.1002/anie.202212393
|
| Study excised MmpB KS-domain preparation | was_tested_in | Study MacpD/MmpB-KS NMR titration | Reported NMR titration, not a catalytic assay or direct native-producer experiment. No unverified dose, stoichiometry, equilibrium affinity or tag sequence adopted. | DOI:10.1002/anie.202212393
|
| Study MacpD/MmpB-KS NMR titration | yielded_reported_readout | No detected MacpD NMR perturbation with MmpB-KS | No observable line broadening or chemical-shift perturbation under the reported test. Not proof of universal absence of binding, turnover or an in-vivo role. | DOI:10.1002/anie.202212393
|
| Study 15N-labelled apo-MacpD preparation | was_tested_in | Study MacpD/MupB NMR titration | Reported NMR titration, not a catalytic assay or direct native-producer experiment. No unverified dose, stoichiometry, equilibrium affinity or tag sequence adopted. | DOI:10.1002/anie.202212393
|
| Study purified MupB preparation | was_tested_in | Study MacpD/MupB NMR titration | Reported NMR titration, not a catalytic assay or direct native-producer experiment. No unverified dose, stoichiometry, equilibrium affinity or tag sequence adopted. | DOI:10.1002/anie.202212393
|
| Study MacpD/MupB NMR titration | yielded_reported_readout | No detected MacpD NMR perturbation with MupB | No observable line broadening or chemical-shift perturbation under the reported test. Not proof of universal absence of binding, turnover or an in-vivo role. | DOI:10.1002/anie.202212393
|
| Native MmpB sequence reference | is_native_parent_sequence_reference_for | Study 15N-labelled excised MmpB-ACP5 preparation | An individually excised,isotope-labelled ACP5 domain,not complete MmpB or an independent native protein. Exact boundaries and expressed sequence remain unverified. | DOI:10.1002/anie.202212393
|
| Study 15N-labelled excised MmpB-ACP5 preparation | was_tested_in | Study MmpB-ACP5/MmpF NMR titration | ACP5 was selected as a representative domain. This does not establish equivalent NMR results for ACP6 or ACP7,or quantitative binding affinity. | DOI:10.1002/anie.202212393
|
| Study purified MmpF preparation | was_tested_in | Study MmpB-ACP5/MmpF NMR titration | ACP5 was selected as a representative domain. This does not establish equivalent NMR results for ACP6 or ACP7,or quantitative binding affinity. | DOI:10.1002/anie.202212393
|
| Study MmpB-ACP5/MmpF NMR titration | yielded_reported_readout | No discernible MmpB-ACP5/MmpF NMR interaction | Bounded main-text NMR nondetection,not universal absence of binding or native function. | DOI:10.1002/anie.202212393
|
Every edge carries its own citation; an uncited edge is refused by the corpus tests.
Causal graph — biosynthesis 16 nodes, 24 edges
Coupled MmpF/MupD first-extension assays with separate MacpA and MacpB acceptors. No native pathway redundancy inferred. Native reference, engineered preparation and study readout remain distinct. Partial primary-main-text curation, not complete pathway reconstitution or full-record sign-off. The exact PAA owner is not the clinical mupirocin mixture.
| Subject | Predicate | Object | Notes | Evidence |
|---|---|---|---|---|
| Native mupirocin locus in NCIMB 10586 | encodes_native_reference | Native MmpF sequence reference | AF318063.3 CDS 63348..65585(+),1-based inclusive; AAM12934.1,745 aa. CDS-aware table-11 translation exactly matches original GenPept and current UniProt. Native source is Pseudomonas fluorescens NCIMB 10586,taxon294. This is not full engineered-proteoform or laboratory-stock identity. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| Native mupirocin locus in NCIMB 10586 | encodes_native_reference | Native MupD sequence reference | AF318063.3 CDS 42216..42959(+),1-based inclusive; AAM12916.1,247 aa. CDS-aware table-11 translation exactly matches original GenPept and current UniProt. Native source is Pseudomonas fluorescens NCIMB 10586,taxon294. This is not full engineered-proteoform or laboratory-stock identity. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| Native mupirocin locus in NCIMB 10586 | encodes_native_reference | Native MacpD sequence reference | AF318063.3 CDS 63031..63351(+),1-based inclusive; AAM12933.1,106 aa. CDS-aware table-11 translation exactly matches original GenPept and current UniProt. Native source is Pseudomonas fluorescens NCIMB 10586,taxon294. This is not full engineered-proteoform or laboratory-stock identity. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| Native mupirocin locus in NCIMB 10586 | encodes_native_reference | Native MacpA sequence reference | AF318063.3 CDS 41870..42175(+),1-based inclusive; AAM12915.1,101 aa. CDS-aware table-11 translation exactly matches original GenPept and current UniProt. Native source is Pseudomonas fluorescens NCIMB 10586,taxon294. This is not full engineered-proteoform or laboratory-stock identity. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| Native mupirocin locus in NCIMB 10586 | encodes_native_reference | Native MacpB sequence reference | AF318063.3 CDS 44062..44313(+),1-based inclusive; AAM12918.1,83 aa. CDS-aware table-11 translation exactly matches original GenPept and current UniProt. Native source is Pseudomonas fluorescens NCIMB 10586,taxon294. This is not full engineered-proteoform or laboratory-stock identity. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| Native MmpF sequence reference | is_native_sequence_reference_for | Study purified MmpF preparation | Gene-matched reference; full fusion identity, vector, purification recipe and exact assay concentration were not verified from SI. | DOI:10.1002/anie.202212393
|
| Native MupD sequence reference | is_native_sequence_reference_for | Study purified MupD preparation | Gene-matched reference; full fusion identity, vector, purification recipe and exact assay concentration were not verified from SI. | DOI:10.1002/anie.202212393
|
| Native MacpD sequence reference | is_native_carrier_reference_for | Study 3-hydroxypropionyl-MacpD preparation | Acyl-loaded carrier is not the unmodified native reference. The donor is used in a purified system, not measured as a native-producer pool. | DOI:10.1002/anie.202212393
|
| Native MacpA sequence reference | is_native_carrier_reference_for | Study malonyl-MacpA preparation | Carrier identity is gene-matched. Acyl loading describes a chemical state, not a demonstrated amino-acid sequence change. Complete engineered sequence and proteoform identity remain unverified. | DOI:10.1002/anie.202212393
|
| Native MacpA sequence reference | is_native_carrier_reference_for | Source-assigned 3,5-dihydroxypentanoyl-MacpA | Carrier identity is gene-matched. Acyl loading describes a chemical state, not a demonstrated amino-acid sequence change. Complete engineered sequence and proteoform identity remain unverified. | DOI:10.1002/anie.202212393
|
| Study purified MmpF preparation | was_component_in | Coupled DCC1/ketoreduction with MacpA | Coupled purified-system assay; participation is not proof of individual-component sufficiency. NAD(P)H wording does not establish a cofactor-preference ratio. | DOI:10.1002/anie.202212393
|
| Study purified MupD preparation | was_component_in | Coupled DCC1/ketoreduction with MacpA | Coupled purified-system assay; participation is not proof of individual-component sufficiency. NAD(P)H wording does not establish a cofactor-preference ratio. | DOI:10.1002/anie.202212393
|
| Study 3-hydroxypropionyl-MacpD preparation | was_component_in | Coupled DCC1/ketoreduction with MacpA | Coupled purified-system assay; participation is not proof of individual-component sufficiency. NAD(P)H wording does not establish a cofactor-preference ratio. | DOI:10.1002/anie.202212393
|
| Study malonyl-MacpA preparation | was_component_in | Coupled DCC1/ketoreduction with MacpA | Coupled purified-system assay; participation is not proof of individual-component sufficiency. NAD(P)H wording does not establish a cofactor-preference ratio. | DOI:10.1002/anie.202212393
|
| Assay NAD(P)H as reported | was_component_in | Coupled DCC1/ketoreduction with MacpA | Coupled purified-system assay; participation is not proof of individual-component sufficiency. NAD(P)H wording does not establish a cofactor-preference ratio. | DOI:10.1002/anie.202212393
|
| Coupled DCC1/ketoreduction with MacpA | yielded_source_assigned_product | Source-assigned 3,5-dihydroxypentanoyl-MacpA | ESI-MS/Ppant-ejection assignment, not a quantitative rate or complete native reconstitution. The paper reports poor conversion without MupD and a C183A MmpF control without product; complete carrier-specific control details remain unverified from inaccessible SI. | DOI:10.1002/anie.202212393
|
| Native MacpB sequence reference | is_native_carrier_reference_for | Study malonyl-MacpB preparation | Carrier identity is gene-matched. Acyl loading describes a chemical state, not a demonstrated amino-acid sequence change. Complete engineered sequence and proteoform identity remain unverified. | DOI:10.1002/anie.202212393
|
| Native MacpB sequence reference | is_native_carrier_reference_for | Source-assigned 3,5-dihydroxypentanoyl-MacpB | Carrier identity is gene-matched. Acyl loading describes a chemical state, not a demonstrated amino-acid sequence change. Complete engineered sequence and proteoform identity remain unverified. | DOI:10.1002/anie.202212393
|
| Study purified MmpF preparation | was_component_in | Coupled DCC1/ketoreduction with MacpB | Coupled purified-system assay; participation is not proof of individual-component sufficiency. NAD(P)H wording does not establish a cofactor-preference ratio. | DOI:10.1002/anie.202212393
|
| Study purified MupD preparation | was_component_in | Coupled DCC1/ketoreduction with MacpB | Coupled purified-system assay; participation is not proof of individual-component sufficiency. NAD(P)H wording does not establish a cofactor-preference ratio. | DOI:10.1002/anie.202212393
|
| Study 3-hydroxypropionyl-MacpD preparation | was_component_in | Coupled DCC1/ketoreduction with MacpB | Coupled purified-system assay; participation is not proof of individual-component sufficiency. NAD(P)H wording does not establish a cofactor-preference ratio. | DOI:10.1002/anie.202212393
|
| Study malonyl-MacpB preparation | was_component_in | Coupled DCC1/ketoreduction with MacpB | Coupled purified-system assay; participation is not proof of individual-component sufficiency. NAD(P)H wording does not establish a cofactor-preference ratio. | DOI:10.1002/anie.202212393
|
| Assay NAD(P)H as reported | was_component_in | Coupled DCC1/ketoreduction with MacpB | Coupled purified-system assay; participation is not proof of individual-component sufficiency. NAD(P)H wording does not establish a cofactor-preference ratio. | DOI:10.1002/anie.202212393
|
| Coupled DCC1/ketoreduction with MacpB | yielded_source_assigned_product | Source-assigned 3,5-dihydroxypentanoyl-MacpB | ESI-MS/Ppant-ejection assignment, not a quantitative rate or complete native reconstitution. The paper reports poor conversion without MupD and a C183A MmpF control without product; complete carrier-specific control details remain unverified from inaccessible SI. | DOI:10.1002/anie.202212393
|
Every edge carries its own citation; an uncited edge is refused by the corpus tests.
Causal graph — biosynthesis 12 nodes, 16 edges
MupE reduction of crotonyl carrier-bound surrogates, without substituting these for native hydroxylated chain intermediates. Native reference, engineered preparation and study readout remain distinct. Partial primary-main-text curation, not complete pathway reconstitution or full-record sign-off. The exact PAA owner is not the clinical mupirocin mixture.
| Subject | Predicate | Object | Notes | Evidence |
|---|---|---|---|---|
| Native mupirocin locus in NCIMB 10586 | encodes_native_reference | Native MupE sequence reference | AF318063.3 CDS 42983..44005(+),1-based inclusive; AAM12917.1,340 aa. CDS-aware table-11 translation exactly matches original GenPept and current UniProt. Native source is Pseudomonas fluorescens NCIMB 10586,taxon294. This is not full engineered-proteoform or laboratory-stock identity. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| Native mupirocin locus in NCIMB 10586 | encodes_native_reference | Native MacpA sequence reference | AF318063.3 CDS 41870..42175(+),1-based inclusive; AAM12915.1,101 aa. CDS-aware table-11 translation exactly matches original GenPept and current UniProt. Native source is Pseudomonas fluorescens NCIMB 10586,taxon294. This is not full engineered-proteoform or laboratory-stock identity. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| Native mupirocin locus in NCIMB 10586 | encodes_native_reference | Native MacpB sequence reference | AF318063.3 CDS 44062..44313(+),1-based inclusive; AAM12918.1,83 aa. CDS-aware table-11 translation exactly matches original GenPept and current UniProt. Native source is Pseudomonas fluorescens NCIMB 10586,taxon294. This is not full engineered-proteoform or laboratory-stock identity. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| Native MupE sequence reference | is_native_sequence_reference_for | Study purified MupE preparation | Gene-matched reference; complete engineered sequence and preparation recipe remain unverified. No exact native-proteoform equality is asserted. | DOI:10.1002/anie.202212393
|
| Native MacpA sequence reference | is_native_carrier_reference_for | Study crotonyl-MacpA surrogate preparation | Acyl-loaded carrier preparation is distinct from the unmodified native sequence reference. | DOI:10.1002/anie.202212393
|
| Native MacpA sequence reference | is_native_carrier_reference_for | Source-assigned butanoyl-MacpA | Acyl-loaded carrier preparation is distinct from the unmodified native sequence reference. | DOI:10.1002/anie.202212393
|
| Study purified MupE preparation | catalyzed | MupE surrogate reduction on MacpA | Purified surrogate assay. No exact dose, numerical turnover rate, cofactor preference or native hydroxylated fatty-chain turnover is inferred. | DOI:10.1002/anie.202212393
|
| Study crotonyl-MacpA surrogate preparation | was_substrate_in | MupE surrogate reduction on MacpA | Purified surrogate assay. No exact dose, numerical turnover rate, cofactor preference or native hydroxylated fatty-chain turnover is inferred. | DOI:10.1002/anie.202212393
|
| Assay NADH | was_supplied_in | MupE surrogate reduction on MacpA | Purified surrogate assay. No exact dose, numerical turnover rate, cofactor preference or native hydroxylated fatty-chain turnover is inferred. | DOI:10.1002/anie.202212393
|
| MupE surrogate reduction on MacpA | yielded_source_assigned_product | Source-assigned butanoyl-MacpA | Source Ppant-ejection mass shift supports reduction of the crotonyl mimic. Not complete mupirocin synthesis or an assay of the intended hydroxylated native substrate. | DOI:10.1002/anie.202212393
|
| Native MacpB sequence reference | is_native_carrier_reference_for | Study crotonyl-MacpB surrogate preparation | Acyl-loaded carrier preparation is distinct from the unmodified native sequence reference. | DOI:10.1002/anie.202212393
|
| Native MacpB sequence reference | is_native_carrier_reference_for | Source-assigned butanoyl-MacpB | Acyl-loaded carrier preparation is distinct from the unmodified native sequence reference. | DOI:10.1002/anie.202212393
|
| Study purified MupE preparation | catalyzed | MupE surrogate reduction on MacpB | Purified surrogate assay. No exact dose, numerical turnover rate, cofactor preference or native hydroxylated fatty-chain turnover is inferred. | DOI:10.1002/anie.202212393
|
| Study crotonyl-MacpB surrogate preparation | was_substrate_in | MupE surrogate reduction on MacpB | Purified surrogate assay. No exact dose, numerical turnover rate, cofactor preference or native hydroxylated fatty-chain turnover is inferred. | DOI:10.1002/anie.202212393
|
| Assay NADH | was_supplied_in | MupE surrogate reduction on MacpB | Purified surrogate assay. No exact dose, numerical turnover rate, cofactor preference or native hydroxylated fatty-chain turnover is inferred. | DOI:10.1002/anie.202212393
|
| MupE surrogate reduction on MacpB | yielded_source_assigned_product | Source-assigned butanoyl-MacpB | Source Ppant-ejection mass shift supports reduction of the crotonyl mimic. Not complete mupirocin synthesis or an assay of the intended hydroxylated native substrate. | DOI:10.1002/anie.202212393
|
Every edge carries its own citation; an uncited edge is refused by the corpus tests.
Causal graph — biosynthesis 21 nodes, 37 edges
MmpF/MupD DCC2 donor and acceptor tests. Pantetheine donors, carrier-bound donors and their negative readouts remain separate. Native reference, engineered preparation and study readout remain distinct. Partial primary-main-text curation, not complete pathway reconstitution or full-record sign-off. The exact PAA owner is not the clinical mupirocin mixture.
| Subject | Predicate | Object | Notes | Evidence |
|---|---|---|---|---|
| Native mupirocin locus in NCIMB 10586 | encodes_native_reference | Native MmpF sequence reference | AF318063.3 CDS 63348..65585(+),1-based inclusive; AAM12934.1,745 aa. CDS-aware table-11 translation exactly matches original GenPept and current UniProt. Native source is Pseudomonas fluorescens NCIMB 10586,taxon294. This is not full engineered-proteoform or laboratory-stock identity. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| Native mupirocin locus in NCIMB 10586 | encodes_native_reference | Native MupD sequence reference | AF318063.3 CDS 42216..42959(+),1-based inclusive; AAM12916.1,247 aa. CDS-aware table-11 translation exactly matches original GenPept and current UniProt. Native source is Pseudomonas fluorescens NCIMB 10586,taxon294. This is not full engineered-proteoform or laboratory-stock identity. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| Native mupirocin locus in NCIMB 10586 | encodes_native_reference | Native MacpA sequence reference | AF318063.3 CDS 41870..42175(+),1-based inclusive; AAM12915.1,101 aa. CDS-aware table-11 translation exactly matches original GenPept and current UniProt. Native source is Pseudomonas fluorescens NCIMB 10586,taxon294. This is not full engineered-proteoform or laboratory-stock identity. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| Native mupirocin locus in NCIMB 10586 | encodes_native_reference | Native MacpB sequence reference | AF318063.3 CDS 44062..44313(+),1-based inclusive; AAM12918.1,83 aa. CDS-aware table-11 translation exactly matches original GenPept and current UniProt. Native source is Pseudomonas fluorescens NCIMB 10586,taxon294. This is not full engineered-proteoform or laboratory-stock identity. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| Native MmpF sequence reference | is_native_sequence_reference_for | Study purified MmpF preparation | Gene-matched reference; complete engineered sequence and assay preparation remain unverified from inaccessible SI. | DOI:10.1002/anie.202212393
|
| Native MupD sequence reference | is_native_sequence_reference_for | Study purified MupD preparation | Gene-matched reference; complete engineered sequence and assay preparation remain unverified from inaccessible SI. | DOI:10.1002/anie.202212393
|
| Native MacpA sequence reference | is_native_carrier_reference_for | Study malonyl-MacpA preparation | Gene-matched carrier reference; acyl state does not identify the complete engineered sequence or establish its concentration in native cells. | DOI:10.1002/anie.202212393
|
| Native MacpA sequence reference | is_native_carrier_reference_for | Study 5-hydroxypentanoyl-MacpA preparation | Gene-matched carrier reference; acyl state does not identify the complete engineered sequence or establish its concentration in native cells. | DOI:10.1002/anie.202212393
|
| Native MacpB sequence reference | is_native_carrier_reference_for | Study malonyl-MacpB preparation | Gene-matched carrier reference; acyl state does not identify the complete engineered sequence or establish its concentration in native cells. | DOI:10.1002/anie.202212393
|
| Native MacpB sequence reference | is_native_carrier_reference_for | Study 5-hydroxypentanoyl-MacpB preparation | Gene-matched carrier reference; acyl state does not identify the complete engineered sequence or establish its concentration in native cells. | DOI:10.1002/anie.202212393
|
| Native MacpA sequence reference | is_native_carrier_reference_for | Source-assigned 3,7-dihydroxyheptanoyl-MacpA | Source-assigned carrier state, not an exact engineered-proteoform identifier. | DOI:10.1002/anie.202212393
|
| Native MacpB sequence reference | is_native_carrier_reference_for | Source-assigned holo-MacpB after donor hydrolysis | Source-assigned carrier state, not an exact engineered-proteoform identifier. | DOI:10.1002/anie.202212393
|
| Study purified MmpF preparation | was_component_in | Study 5HP-pantetheine/MacpA acceptor DCC2 assay | Coupled purified-system test. Donor, acceptor and cofactor roles are confined to this assay; no individual sufficiency or complete in-vivo cycle inferred. | DOI:10.1002/anie.202212393
|
| Study purified MupD preparation | was_component_in | Study 5HP-pantetheine/MacpA acceptor DCC2 assay | Coupled purified-system test. Donor, acceptor and cofactor roles are confined to this assay; no individual sufficiency or complete in-vivo cycle inferred. | DOI:10.1002/anie.202212393
|
| Assay NAD(P)H as reported | was_component_in | Study 5HP-pantetheine/MacpA acceptor DCC2 assay | Coupled purified-system test. Donor, acceptor and cofactor roles are confined to this assay; no individual sufficiency or complete in-vivo cycle inferred. | DOI:10.1002/anie.202212393
|
| Synthetic 5-hydroxypentanoyl pantetheine donor | was_component_in | Study 5HP-pantetheine/MacpA acceptor DCC2 assay | Coupled purified-system test. Donor, acceptor and cofactor roles are confined to this assay; no individual sufficiency or complete in-vivo cycle inferred. | DOI:10.1002/anie.202212393
|
| Study malonyl-MacpA preparation | was_component_in | Study 5HP-pantetheine/MacpA acceptor DCC2 assay | Coupled purified-system test. Donor, acceptor and cofactor roles are confined to this assay; no individual sufficiency or complete in-vivo cycle inferred. | DOI:10.1002/anie.202212393
|
| Study 5HP-pantetheine/MacpA acceptor DCC2 assay | yielded_source_assigned_product | Source-assigned 3,7-dihydroxyheptanoyl-MacpA | ESI-MS/Ppant-ejection assignment of the C7 dihydroxy carrier product, not full 9HN or PAA. The main text reports no such product with C183A MmpF; full mutant construct and control recipe remain unverified. | DOI:10.1002/anie.202212393
|
| Study purified MmpF preparation | was_component_in | Study 5HP-pantetheine/MacpB acceptor DCC2 assay | Coupled purified-system test. Donor, acceptor and cofactor roles are confined to this assay; no individual sufficiency or complete in-vivo cycle inferred. | DOI:10.1002/anie.202212393
|
| Study purified MupD preparation | was_component_in | Study 5HP-pantetheine/MacpB acceptor DCC2 assay | Coupled purified-system test. Donor, acceptor and cofactor roles are confined to this assay; no individual sufficiency or complete in-vivo cycle inferred. | DOI:10.1002/anie.202212393
|
| Assay NAD(P)H as reported | was_component_in | Study 5HP-pantetheine/MacpB acceptor DCC2 assay | Coupled purified-system test. Donor, acceptor and cofactor roles are confined to this assay; no individual sufficiency or complete in-vivo cycle inferred. | DOI:10.1002/anie.202212393
|
| Synthetic 5-hydroxypentanoyl pantetheine donor | was_component_in | Study 5HP-pantetheine/MacpB acceptor DCC2 assay | Coupled purified-system test. Donor, acceptor and cofactor roles are confined to this assay; no individual sufficiency or complete in-vivo cycle inferred. | DOI:10.1002/anie.202212393
|
| Study malonyl-MacpB preparation | was_component_in | Study 5HP-pantetheine/MacpB acceptor DCC2 assay | Coupled purified-system test. Donor, acceptor and cofactor roles are confined to this assay; no individual sufficiency or complete in-vivo cycle inferred. | DOI:10.1002/anie.202212393
|
| Study 5HP-pantetheine/MacpB acceptor DCC2 assay | yielded_reported_readout | No detected 3,7-dihydroxyheptanoyl-MacpB product | Bounded failure to detect the stated assay product, not universal nonreactivity or absence of a native biosynthetic role. | DOI:10.1002/anie.202212393
|
| Study purified MmpF preparation | was_component_in | Study 5HP-MacpA/MacpA acceptor DCC2 assay | Coupled purified-system test. Donor, acceptor and cofactor roles are confined to this assay; no individual sufficiency or complete in-vivo cycle inferred. | DOI:10.1002/anie.202212393
|
| Study purified MupD preparation | was_component_in | Study 5HP-MacpA/MacpA acceptor DCC2 assay | Coupled purified-system test. Donor, acceptor and cofactor roles are confined to this assay; no individual sufficiency or complete in-vivo cycle inferred. | DOI:10.1002/anie.202212393
|
| Assay NAD(P)H as reported | was_component_in | Study 5HP-MacpA/MacpA acceptor DCC2 assay | Coupled purified-system test. Donor, acceptor and cofactor roles are confined to this assay; no individual sufficiency or complete in-vivo cycle inferred. | DOI:10.1002/anie.202212393
|
| Study 5-hydroxypentanoyl-MacpA preparation | was_component_in | Study 5HP-MacpA/MacpA acceptor DCC2 assay | Coupled purified-system test. Donor, acceptor and cofactor roles are confined to this assay; no individual sufficiency or complete in-vivo cycle inferred. | DOI:10.1002/anie.202212393
|
| Study malonyl-MacpA preparation | was_component_in | Study 5HP-MacpA/MacpA acceptor DCC2 assay | Coupled purified-system test. Donor, acceptor and cofactor roles are confined to this assay; no individual sufficiency or complete in-vivo cycle inferred. | DOI:10.1002/anie.202212393
|
| Study 5HP-MacpA/MacpA acceptor DCC2 assay | yielded_source_assigned_product | Source-assigned 3,7-dihydroxyheptanoyl-MacpA | ESI-MS/Ppant-ejection assignment of the C7 dihydroxy carrier product, not full 9HN or PAA. The paper also reports a side-product assignment; no exclusive product selectivity is asserted. | DOI:10.1002/anie.202212393
|
| Study purified MmpF preparation | was_component_in | Study 5HP-MacpB/MacpA acceptor DCC2 assay | Coupled purified-system test. Donor, acceptor and cofactor roles are confined to this assay; no individual sufficiency or complete in-vivo cycle inferred. | DOI:10.1002/anie.202212393
|
| Study purified MupD preparation | was_component_in | Study 5HP-MacpB/MacpA acceptor DCC2 assay | Coupled purified-system test. Donor, acceptor and cofactor roles are confined to this assay; no individual sufficiency or complete in-vivo cycle inferred. | DOI:10.1002/anie.202212393
|
| Assay NAD(P)H as reported | was_component_in | Study 5HP-MacpB/MacpA acceptor DCC2 assay | Coupled purified-system test. Donor, acceptor and cofactor roles are confined to this assay; no individual sufficiency or complete in-vivo cycle inferred. | DOI:10.1002/anie.202212393
|
| Study 5-hydroxypentanoyl-MacpB preparation | was_component_in | Study 5HP-MacpB/MacpA acceptor DCC2 assay | Coupled purified-system test. Donor, acceptor and cofactor roles are confined to this assay; no individual sufficiency or complete in-vivo cycle inferred. | DOI:10.1002/anie.202212393
|
| Study malonyl-MacpA preparation | was_component_in | Study 5HP-MacpB/MacpA acceptor DCC2 assay | Coupled purified-system test. Donor, acceptor and cofactor roles are confined to this assay; no individual sufficiency or complete in-vivo cycle inferred. | DOI:10.1002/anie.202212393
|
| Study 5HP-MacpB/MacpA acceptor DCC2 assay | yielded_reported_readout | No detected C7 product with 5HP-MacpB donor | Bounded failure to detect the stated assay product, not universal nonreactivity or absence of a native biosynthetic role. | DOI:10.1002/anie.202212393
|
| Study 5HP-MacpB/MacpA acceptor DCC2 assay | yielded_source_assigned_carrier_state | Source-assigned holo-MacpB after donor hydrolysis | The main text reports donor hydrolysis to holo-MacpB with malonyl-MacpA remaining unchanged. No hydrolysis enzyme or rate is assigned. | DOI:10.1002/anie.202212393
|
Every edge carries its own citation; an uncited edge is refused by the corpus tests.
Causal graph — biosynthesis 18 nodes, 17 edges
MmpB-KS self-loading tests of synthetic chain-length analogues. Priming is not catalytic turnover. Native reference, engineered preparation and study readout remain distinct. Partial primary-main-text curation, not complete pathway reconstitution or full-record sign-off. The exact PAA owner is not the clinical mupirocin mixture.
| Subject | Predicate | Object | Notes | Evidence |
|---|---|---|---|---|
| Native mupirocin locus in NCIMB 10586 | encodes_native_reference | Native MmpB sequence reference | AF318063.3 CDS 11325..17555(+),1-based inclusive; AAM12911.1,2076 aa. CDS-aware table-11 translation exactly matches original GenPept and current UniProt. Native source is Pseudomonas fluorescens NCIMB 10586,taxon294. This is not full engineered-proteoform or laboratory-stock identity. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| Native MmpB sequence reference | is_native_sequence_reference_for | Study excised MmpB KS-domain preparation | The tested KS domain is excised from MmpB, not the full 2076-aa protein. Exact domain boundaries, tags and complete construct sequence remain unverified. | DOI:10.1002/anie.202212393
|
| Study excised MmpB KS-domain preparation | was_tested_in | MmpB-KS C7 self-loading assay | Purified-domain self-loading test, not an ACP-dependent extension assay or evidence of iterative full-length MmpB turnover. | DOI:10.1002/anie.202212393
|
| Synthetic 7-hydroxyheptanoyl pantetheine | was_tested_in | MmpB-KS C7 self-loading assay | Purified-domain self-loading test, not an ACP-dependent extension assay or evidence of iterative full-length MmpB turnover. | DOI:10.1002/anie.202212393
|
| MmpB-KS C7 self-loading assay | yielded_reported_readout | Reported C7 self-loading | Reported priming is not demonstration of chain-extension turnover. | DOI:10.1002/anie.202212393
|
| Study excised MmpB KS-domain preparation | was_tested_in | MmpB-KS C6 self-loading assay | Purified-domain self-loading test, not an ACP-dependent extension assay or evidence of iterative full-length MmpB turnover. | DOI:10.1002/anie.202212393
|
| Synthetic 6-hydroxyhexanoyl pantetheine | was_tested_in | MmpB-KS C6 self-loading assay | Purified-domain self-loading test, not an ACP-dependent extension assay or evidence of iterative full-length MmpB turnover. | DOI:10.1002/anie.202212393
|
| MmpB-KS C6 self-loading assay | yielded_reported_readout | Reported C6 self-loading | Reported priming is not demonstration of chain-extension turnover. The non-natural C6 analogue showed less loading than C7; no quantitative selectivity ratio is adopted. | DOI:10.1002/anie.202212393
|
| Study excised MmpB KS-domain preparation | was_tested_in | MmpB-KS C5 self-loading assay | Purified-domain self-loading test, not an ACP-dependent extension assay or evidence of iterative full-length MmpB turnover. | DOI:10.1002/anie.202212393
|
| Synthetic 5-hydroxypentanoyl pantetheine | was_tested_in | MmpB-KS C5 self-loading assay | Purified-domain self-loading test, not an ACP-dependent extension assay or evidence of iterative full-length MmpB turnover. | DOI:10.1002/anie.202212393
|
| MmpB-KS C5 self-loading assay | yielded_reported_readout | No detected C5 self-loading | No self-loading reported under the tested conditions; not universal substrate exclusion. | DOI:10.1002/anie.202212393
|
| Study excised MmpB KS-domain preparation | was_tested_in | MmpB-KS C9 self-loading assay | Purified-domain self-loading test, not an ACP-dependent extension assay or evidence of iterative full-length MmpB turnover. | DOI:10.1002/anie.202212393
|
| Synthetic 9-hydroxynonanoyl pantetheine | was_tested_in | MmpB-KS C9 self-loading assay | Purified-domain self-loading test, not an ACP-dependent extension assay or evidence of iterative full-length MmpB turnover. | DOI:10.1002/anie.202212393
|
| MmpB-KS C9 self-loading assay | yielded_reported_readout | No detected C9 self-loading | No self-loading reported under the tested conditions; not universal substrate exclusion. | DOI:10.1002/anie.202212393
|
| Study excised MmpB KS-domain preparation | was_tested_in | MmpB-KS C4 self-loading assay | Purified-domain self-loading test, not an ACP-dependent extension assay or evidence of iterative full-length MmpB turnover. | DOI:10.1002/anie.202212393
|
| Synthetic 4-hydroxybutanoyl pantetheine | was_tested_in | MmpB-KS C4 self-loading assay | Purified-domain self-loading test, not an ACP-dependent extension assay or evidence of iterative full-length MmpB turnover. | DOI:10.1002/anie.202212393
|
| MmpB-KS C4 self-loading assay | yielded_reported_readout | No detected C4 self-loading | No self-loading reported under the tested conditions; not universal substrate exclusion. | DOI:10.1002/anie.202212393
|
Every edge carries its own citation; an uncited edge is refused by the corpus tests.
Causal graph — biosynthesis 35 nodes, 51 edges
MmpB-KS DCC3 with separately excised ACP5/6/7 acceptors and bounded carrier-donor comparisons. No full reductive cycle inferred. Native reference, engineered preparation and study readout remain distinct. Partial primary-main-text curation, not complete pathway reconstitution or full-record sign-off. The exact PAA owner is not the clinical mupirocin mixture.
| Subject | Predicate | Object | Notes | Evidence |
|---|---|---|---|---|
| Native mupirocin locus in NCIMB 10586 | encodes_native_reference | Native MmpB sequence reference | AF318063.3 CDS 11325..17555(+),1-based inclusive; AAM12911.1,2076 aa. CDS-aware table-11 translation exactly matches original GenPept and current UniProt. Native source is Pseudomonas fluorescens NCIMB 10586,taxon294. This is not full engineered-proteoform or laboratory-stock identity. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| Native mupirocin locus in NCIMB 10586 | encodes_native_reference | Native MacpA sequence reference | AF318063.3 CDS 41870..42175(+),1-based inclusive; AAM12915.1,101 aa. CDS-aware table-11 translation exactly matches original GenPept and current UniProt. Native source is Pseudomonas fluorescens NCIMB 10586,taxon294. This is not full engineered-proteoform or laboratory-stock identity. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| Native mupirocin locus in NCIMB 10586 | encodes_native_reference | Native MacpB sequence reference | AF318063.3 CDS 44062..44313(+),1-based inclusive; AAM12918.1,83 aa. CDS-aware table-11 translation exactly matches original GenPept and current UniProt. Native source is Pseudomonas fluorescens NCIMB 10586,taxon294. This is not full engineered-proteoform or laboratory-stock identity. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| Native MmpB sequence reference | is_native_sequence_reference_for | Study excised MmpB KS-domain preparation | Excised KS, not the full-length native MmpB; complete domain boundaries and construct sequence remain unverified. | DOI:10.1002/anie.202212393
|
| Native MmpB sequence reference | is_native_parent_sequence_reference_for | Study malonyl-MmpB-ACP5 excised-domain preparation | The ACP is an individual excised MmpB domain, not an independent native gene product or the complete protein. Acyl state and engineered sequence are distinct. | DOI:10.1002/anie.202212393
|
| Native MmpB sequence reference | is_native_parent_sequence_reference_for | Source-assigned 9-hydroxy-3-oxononanoyl-ACP5 | The ACP is an individual excised MmpB domain, not an independent native gene product or the complete protein. Acyl state and engineered sequence are distinct. | DOI:10.1002/anie.202212393
|
| Study excised MmpB KS-domain preparation | was_component_in | MmpB-KS DCC3 with pantetheine donor and ACP5 | Purified excised-domain extension assay; no assertion that full-length tandem ACPs are interchangeable in native cells. | DOI:10.1002/anie.202212393
|
| Synthetic 7-hydroxyheptanoyl pantetheine donor | was_component_in | MmpB-KS DCC3 with pantetheine donor and ACP5 | Purified excised-domain extension assay; no assertion that full-length tandem ACPs are interchangeable in native cells. | DOI:10.1002/anie.202212393
|
| Study malonyl-MmpB-ACP5 excised-domain preparation | was_component_in | MmpB-KS DCC3 with pantetheine donor and ACP5 | Purified excised-domain extension assay; no assertion that full-length tandem ACPs are interchangeable in native cells. | DOI:10.1002/anie.202212393
|
| MmpB-KS DCC3 with pantetheine donor and ACP5 | yielded_source_assigned_product | Source-assigned 9-hydroxy-3-oxononanoyl-ACP5 | Source MS/Ppant assignment of the C9 beta-keto product, not fully reduced 9HN or complete PAA. Main text reports loss of activity upon KS denaturation; full carrier-specific control recipes remain unverified. | DOI:10.1002/anie.202212393
|
| Native MmpB sequence reference | is_native_parent_sequence_reference_for | Study malonyl-MmpB-ACP6 excised-domain preparation | The ACP is an individual excised MmpB domain, not an independent native gene product or the complete protein. Acyl state and engineered sequence are distinct. | DOI:10.1002/anie.202212393
|
| Native MmpB sequence reference | is_native_parent_sequence_reference_for | Source-assigned 9-hydroxy-3-oxononanoyl-ACP6 | The ACP is an individual excised MmpB domain, not an independent native gene product or the complete protein. Acyl state and engineered sequence are distinct. | DOI:10.1002/anie.202212393
|
| Study excised MmpB KS-domain preparation | was_component_in | MmpB-KS DCC3 with pantetheine donor and ACP6 | Purified excised-domain extension assay; no assertion that full-length tandem ACPs are interchangeable in native cells. | DOI:10.1002/anie.202212393
|
| Synthetic 7-hydroxyheptanoyl pantetheine donor | was_component_in | MmpB-KS DCC3 with pantetheine donor and ACP6 | Purified excised-domain extension assay; no assertion that full-length tandem ACPs are interchangeable in native cells. | DOI:10.1002/anie.202212393
|
| Study malonyl-MmpB-ACP6 excised-domain preparation | was_component_in | MmpB-KS DCC3 with pantetheine donor and ACP6 | Purified excised-domain extension assay; no assertion that full-length tandem ACPs are interchangeable in native cells. | DOI:10.1002/anie.202212393
|
| MmpB-KS DCC3 with pantetheine donor and ACP6 | yielded_source_assigned_product | Source-assigned 9-hydroxy-3-oxononanoyl-ACP6 | Source MS/Ppant assignment of the C9 beta-keto product, not fully reduced 9HN or complete PAA. Main text reports loss of activity upon KS denaturation; full carrier-specific control recipes remain unverified. | DOI:10.1002/anie.202212393
|
| Native MmpB sequence reference | is_native_parent_sequence_reference_for | Study malonyl-MmpB-ACP7 excised-domain preparation | The ACP is an individual excised MmpB domain, not an independent native gene product or the complete protein. Acyl state and engineered sequence are distinct. | DOI:10.1002/anie.202212393
|
| Native MmpB sequence reference | is_native_parent_sequence_reference_for | Source-assigned 9-hydroxy-3-oxononanoyl-ACP7 | The ACP is an individual excised MmpB domain, not an independent native gene product or the complete protein. Acyl state and engineered sequence are distinct. | DOI:10.1002/anie.202212393
|
| Study excised MmpB KS-domain preparation | was_component_in | MmpB-KS DCC3 with pantetheine donor and ACP7 | Purified excised-domain extension assay; no assertion that full-length tandem ACPs are interchangeable in native cells. | DOI:10.1002/anie.202212393
|
| Synthetic 7-hydroxyheptanoyl pantetheine donor | was_component_in | MmpB-KS DCC3 with pantetheine donor and ACP7 | Purified excised-domain extension assay; no assertion that full-length tandem ACPs are interchangeable in native cells. | DOI:10.1002/anie.202212393
|
| Study malonyl-MmpB-ACP7 excised-domain preparation | was_component_in | MmpB-KS DCC3 with pantetheine donor and ACP7 | Purified excised-domain extension assay; no assertion that full-length tandem ACPs are interchangeable in native cells. | DOI:10.1002/anie.202212393
|
| MmpB-KS DCC3 with pantetheine donor and ACP7 | yielded_source_assigned_product | Source-assigned 9-hydroxy-3-oxononanoyl-ACP7 | Source MS/Ppant assignment of the C9 beta-keto product, not fully reduced 9HN or complete PAA. Main text reports loss of activity upon KS denaturation; full carrier-specific control recipes remain unverified. | DOI:10.1002/anie.202212393
|
| Native MacpA sequence reference | is_native_carrier_reference_for | Study 7-hydroxyheptanoyl-MacpA donor preparation | Gene-matched carrier reference only; full construct sequence and chemical-state identity are not represented by the native accession. | DOI:10.1002/anie.202212393
|
| Native MacpB sequence reference | is_native_carrier_reference_for | Study 7-hydroxyheptanoyl-MacpB donor preparation | Gene-matched carrier reference only; full construct sequence and chemical-state identity are not represented by the native accession. | DOI:10.1002/anie.202212393
|
| Native MmpB sequence reference | is_native_parent_sequence_reference_for | Study 7-hydroxyheptanoyl-MmpB-ACP5 donor preparation | Acylated excised ACP5 domain, not the complete MmpB protein or an independently encoded ACP. | DOI:10.1002/anie.202212393
|
| Study excised MmpB KS-domain preparation | was_component_in | MmpB-KS DCC3 with MacpA donor and ACP5 acceptor | Donor-ACP comparison with malonyl-ACP5 acceptor. No complete native pathway timing or stable protein-complex claim. | DOI:10.1002/anie.202212393
|
| Study 7-hydroxyheptanoyl-MacpA donor preparation | was_component_in | MmpB-KS DCC3 with MacpA donor and ACP5 acceptor | Donor-ACP comparison with malonyl-ACP5 acceptor. No complete native pathway timing or stable protein-complex claim. | DOI:10.1002/anie.202212393
|
| Study malonyl-MmpB-ACP5 excised-domain preparation | was_component_in | MmpB-KS DCC3 with MacpA donor and ACP5 acceptor | Donor-ACP comparison with malonyl-ACP5 acceptor. No complete native pathway timing or stable protein-complex claim. | DOI:10.1002/anie.202212393
|
| MmpB-KS DCC3 with MacpA donor and ACP5 acceptor | yielded_source_assigned_product | Source-assigned 9-hydroxy-3-oxononanoyl-ACP5 | MS/Ppant assignment supports C7-chain delivery from MacpA and C9 beta-keto product formation in this assay, not the remaining reductive steps. | DOI:10.1002/anie.202212393
|
| Study excised MmpB KS-domain preparation | was_component_in | MmpB-KS DCC3 with MacpB donor and ACP5 acceptor | Donor-ACP comparison with malonyl-ACP5 acceptor. No complete native pathway timing or stable protein-complex claim. | DOI:10.1002/anie.202212393
|
| Study 7-hydroxyheptanoyl-MacpB donor preparation | was_component_in | MmpB-KS DCC3 with MacpB donor and ACP5 acceptor | Donor-ACP comparison with malonyl-ACP5 acceptor. No complete native pathway timing or stable protein-complex claim. | DOI:10.1002/anie.202212393
|
| Study malonyl-MmpB-ACP5 excised-domain preparation | was_component_in | MmpB-KS DCC3 with MacpB donor and ACP5 acceptor | Donor-ACP comparison with malonyl-ACP5 acceptor. No complete native pathway timing or stable protein-complex claim. | DOI:10.1002/anie.202212393
|
| MmpB-KS DCC3 with MacpB donor and ACP5 acceptor | yielded_reported_readout | No detected transfer or DCC3 turnover from MacpB donor | Bounded negative assay; not universal lack of binding or function. The source reports stable 7HH-MacpB, unlike 5HP-MacpB hydrolysis in the distinct DCC2 assay. | DOI:10.1002/anie.202212393
|
| Study excised MmpB KS-domain preparation | was_component_in | MmpB-KS DCC3 with MmpB-ACP5 donor and ACP5 acceptor | Donor-ACP comparison with malonyl-ACP5 acceptor. No complete native pathway timing or stable protein-complex claim. | DOI:10.1002/anie.202212393
|
| Study 7-hydroxyheptanoyl-MmpB-ACP5 donor preparation | was_component_in | MmpB-KS DCC3 with MmpB-ACP5 donor and ACP5 acceptor | Donor-ACP comparison with malonyl-ACP5 acceptor. No complete native pathway timing or stable protein-complex claim. | DOI:10.1002/anie.202212393
|
| Study malonyl-MmpB-ACP5 excised-domain preparation | was_component_in | MmpB-KS DCC3 with MmpB-ACP5 donor and ACP5 acceptor | Donor-ACP comparison with malonyl-ACP5 acceptor. No complete native pathway timing or stable protein-complex claim. | DOI:10.1002/anie.202212393
|
| MmpB-KS DCC3 with MmpB-ACP5 donor and ACP5 acceptor | yielded_reported_readout | No detected transfer or DCC3 turnover from MmpB-ACP5 donor | Bounded negative assay; not universal lack of binding or function. | DOI:10.1002/anie.202212393
|
| Study excised MmpB KS-domain preparation | was_tested_in | Reported MmpB-KS C5 DCC3 substrate-control assay | Main-text substrate-control report. Exact ACP acceptor and complete control recipe are not verified from inaccessible SI; no particular ACP5/6/7 assignment. | DOI:10.1002/anie.202212393
|
| Synthetic 5-hydroxypentanoyl pantetheine donor | was_tested_in | Reported MmpB-KS C5 DCC3 substrate-control assay | Main-text substrate-control report. Exact ACP acceptor and complete control recipe are not verified from inaccessible SI; no particular ACP5/6/7 assignment. | DOI:10.1002/anie.202212393
|
| Reported MmpB-KS C5 DCC3 substrate-control assay | yielded_reported_readout | No detected DCC3 turnover with C5 pantetheine | No reported turnover under these conditions,not universal substrate exclusion. | DOI:10.1002/anie.202212393
|
| Study excised MmpB KS-domain preparation | was_tested_in | Reported MmpB-KS C6 DCC3 substrate-control assay | Main-text substrate-control report. Exact ACP acceptor and complete control recipe are not verified from inaccessible SI; no particular ACP5/6/7 assignment. | DOI:10.1002/anie.202212393
|
| Synthetic 6-hydroxyhexanoyl pantetheine donor | was_tested_in | Reported MmpB-KS C6 DCC3 substrate-control assay | Main-text substrate-control report. Exact ACP acceptor and complete control recipe are not verified from inaccessible SI; no particular ACP5/6/7 assignment. | DOI:10.1002/anie.202212393
|
| Reported MmpB-KS C6 DCC3 substrate-control assay | yielded_reported_readout | No detected DCC3 turnover with C6 pantetheine | No reported turnover under these conditions,not universal substrate exclusion. C6 self-loading in a distinct assay did not establish catalytic chain extension. | DOI:10.1002/anie.202212393
|
| Native MacpA sequence reference | is_native_carrier_reference_for | Study malonyl-MacpA preparation | Gene-matched reference; acyl state does not identify the complete engineered preparation. | DOI:10.1002/anie.202212393
|
| Study excised MmpB KS-domain preparation | was_tested_in | Reported DCC3 MacpA acceptor-substitution assay | Main text reports inability to substitute for MmpB ACP domains as malonyl acceptor. Complete donor/acceptor-control recipe remains unverified from SI. | DOI:10.1002/anie.202212393
|
| Study malonyl-MacpA preparation | was_tested_in | Reported DCC3 MacpA acceptor-substitution assay | Main text reports inability to substitute for MmpB ACP domains as malonyl acceptor. Complete donor/acceptor-control recipe remains unverified from SI. | DOI:10.1002/anie.202212393
|
| Reported DCC3 MacpA acceptor-substitution assay | yielded_reported_readout | No successful DCC3 acceptor substitution by MacpA | Bounded acceptor-substitution result,not universal absence of native function. MacpA supported donor transfer in the distinct 7HH-MacpA assay. | DOI:10.1002/anie.202212393
|
| Native MacpB sequence reference | is_native_carrier_reference_for | Study malonyl-MacpB preparation | Gene-matched reference; acyl state does not identify the complete engineered preparation. | DOI:10.1002/anie.202212393
|
| Study excised MmpB KS-domain preparation | was_tested_in | Reported DCC3 MacpB acceptor-substitution assay | Main text reports inability to substitute for MmpB ACP domains as malonyl acceptor. Complete donor/acceptor-control recipe remains unverified from SI. | DOI:10.1002/anie.202212393
|
| Study malonyl-MacpB preparation | was_tested_in | Reported DCC3 MacpB acceptor-substitution assay | Main text reports inability to substitute for MmpB ACP domains as malonyl acceptor. Complete donor/acceptor-control recipe remains unverified from SI. | DOI:10.1002/anie.202212393
|
| Reported DCC3 MacpB acceptor-substitution assay | yielded_reported_readout | No successful DCC3 acceptor substitution by MacpB | Bounded acceptor-substitution result,not universal absence of native function. MacpB donor nondetection was separately measured with 7HH-MacpB; it is not inferred from this acceptor test. | DOI:10.1002/anie.202212393
|
Every edge carries its own citation; an uncited edge is refused by the corpus tests.
Causal graph — biosynthesis 17 nodes, 24 edges
Separate MmpD-DH1 and MmpB-DH supplementation tests with no reported dehydration. No native dehydratase assignment inferred. Native reference, engineered preparation and study readout remain distinct. Partial primary-main-text curation, not complete pathway reconstitution or full-record sign-off. The exact PAA owner is not the clinical mupirocin mixture.
| Subject | Predicate | Object | Notes | Evidence |
|---|---|---|---|---|
| Native mupirocin locus in NCIMB 10586 | encodes_native_reference | Native MmpB sequence reference | AF318063.3 CDS 11325..17555(+),1-based inclusive; AAM12911.1,2076 aa. CDS-aware table-11 translation exactly matches original GenPept and current UniProt. Native source is Pseudomonas fluorescens NCIMB 10586,taxon294. This is not full engineered-proteoform or laboratory-stock identity. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| Native mupirocin locus in NCIMB 10586 | encodes_native_reference | Native MmpF sequence reference | AF318063.3 CDS 63348..65585(+),1-based inclusive; AAM12934.1,745 aa. CDS-aware table-11 translation exactly matches original GenPept and current UniProt. Native source is Pseudomonas fluorescens NCIMB 10586,taxon294. This is not full engineered-proteoform or laboratory-stock identity. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| Native mupirocin locus in NCIMB 10586 | encodes_native_reference | Native MupD sequence reference | AF318063.3 CDS 42216..42959(+),1-based inclusive; AAM12916.1,247 aa. CDS-aware table-11 translation exactly matches original GenPept and current UniProt. Native source is Pseudomonas fluorescens NCIMB 10586,taxon294. This is not full engineered-proteoform or laboratory-stock identity. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| Native mupirocin locus in NCIMB 10586 | encodes_native_reference | Native MacpD sequence reference | AF318063.3 CDS 63031..63351(+),1-based inclusive; AAM12933.1,106 aa. CDS-aware table-11 translation exactly matches original GenPept and current UniProt. Native source is Pseudomonas fluorescens NCIMB 10586,taxon294. This is not full engineered-proteoform or laboratory-stock identity. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| Native mupirocin locus in NCIMB 10586 | encodes_native_reference | Native MacpB sequence reference | AF318063.3 CDS 44062..44313(+),1-based inclusive; AAM12918.1,83 aa. CDS-aware table-11 translation exactly matches original GenPept and current UniProt. Native source is Pseudomonas fluorescens NCIMB 10586,taxon294. This is not full engineered-proteoform or laboratory-stock identity. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| Native mupirocin locus in NCIMB 10586 | encodes_native_reference | Native MmpD sequence reference | AF318063.3 CDS20958..40526(+),1-based inclusive; AAM12913.2,6522aa. Exact CDS-aware table11/GenPept/current UniProt match,NCIMB10586,taxon294. Q8RL72 sequenceversion2, not version1. This is the native parent,not the excised DH1 preparation. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| Native MmpD sequence reference | is_native_parent_sequence_reference_for | Study excised MmpD-DH1 preparation | Excised domain from the named native parent,not the complete protein. Exact boundaries,tags and full expressed sequence remain unverified from inaccessible SI. | DOI:10.1002/anie.202212393
|
| Native MmpB sequence reference | is_native_parent_sequence_reference_for | Study excised MmpB-DH preparation | Excised domain from the named native parent,not the complete protein. Exact boundaries,tags and full expressed sequence remain unverified from inaccessible SI. | DOI:10.1002/anie.202212393
|
| Native MmpF sequence reference | is_native_sequence_reference_for | Study purified MmpF preparation | Gene-matched native reference,not complete tagged/acylated preparation identity. | DOI:10.1002/anie.202212393
|
| Native MupD sequence reference | is_native_sequence_reference_for | Study purified MupD preparation | Gene-matched native reference,not complete tagged/acylated preparation identity. | DOI:10.1002/anie.202212393
|
| Native MacpD sequence reference | is_native_sequence_reference_for | Study 3-hydroxypropionyl-MacpD preparation | Gene-matched native reference,not complete tagged/acylated preparation identity. | DOI:10.1002/anie.202212393
|
| Native MacpB sequence reference | is_native_sequence_reference_for | Study malonyl-MacpB preparation | Gene-matched native reference,not complete tagged/acylated preparation identity. | DOI:10.1002/anie.202212393
|
| Study excised MmpD-DH1 preparation | was_component_in | Extended DCC1 assay supplemented with MmpD-DH1 | Main-text extended Claisen-condensation assay,using MacpB acceptor. Complete recipe,concentrations and cofactor composition were not verified from SI. | DOI:10.1002/anie.202212393
|
| Study purified MmpF preparation | was_component_in | Extended DCC1 assay supplemented with MmpD-DH1 | Main-text extended Claisen-condensation assay,using MacpB acceptor. Complete recipe,concentrations and cofactor composition were not verified from SI. | DOI:10.1002/anie.202212393
|
| Study purified MupD preparation | was_component_in | Extended DCC1 assay supplemented with MmpD-DH1 | Main-text extended Claisen-condensation assay,using MacpB acceptor. Complete recipe,concentrations and cofactor composition were not verified from SI. | DOI:10.1002/anie.202212393
|
| Study 3-hydroxypropionyl-MacpD preparation | was_component_in | Extended DCC1 assay supplemented with MmpD-DH1 | Main-text extended Claisen-condensation assay,using MacpB acceptor. Complete recipe,concentrations and cofactor composition were not verified from SI. | DOI:10.1002/anie.202212393
|
| Study malonyl-MacpB preparation | was_component_in | Extended DCC1 assay supplemented with MmpD-DH1 | Main-text extended Claisen-condensation assay,using MacpB acceptor. Complete recipe,concentrations and cofactor composition were not verified from SI. | DOI:10.1002/anie.202212393
|
| Extended DCC1 assay supplemented with MmpD-DH1 | yielded_reported_readout | No detected dehydration with added MmpD-DH1 | No dehydration reported in this supplied-domain context. Not a universal claim that the domain is inactive,that full-length parent lacks function,or that a particular native replacement enzyme was established. No rate or detection limit adopted. | DOI:10.1002/anie.202212393
|
| Study excised MmpB-DH preparation | was_component_in | Extended DCC1 assay supplemented with MmpB-DH | Main-text extended Claisen-condensation assay,using MacpB acceptor. Complete recipe,concentrations and cofactor composition were not verified from SI. | DOI:10.1002/anie.202212393
|
| Study purified MmpF preparation | was_component_in | Extended DCC1 assay supplemented with MmpB-DH | Main-text extended Claisen-condensation assay,using MacpB acceptor. Complete recipe,concentrations and cofactor composition were not verified from SI. | DOI:10.1002/anie.202212393
|
| Study purified MupD preparation | was_component_in | Extended DCC1 assay supplemented with MmpB-DH | Main-text extended Claisen-condensation assay,using MacpB acceptor. Complete recipe,concentrations and cofactor composition were not verified from SI. | DOI:10.1002/anie.202212393
|
| Study 3-hydroxypropionyl-MacpD preparation | was_component_in | Extended DCC1 assay supplemented with MmpB-DH | Main-text extended Claisen-condensation assay,using MacpB acceptor. Complete recipe,concentrations and cofactor composition were not verified from SI. | DOI:10.1002/anie.202212393
|
| Study malonyl-MacpB preparation | was_component_in | Extended DCC1 assay supplemented with MmpB-DH | Main-text extended Claisen-condensation assay,using MacpB acceptor. Complete recipe,concentrations and cofactor composition were not verified from SI. | DOI:10.1002/anie.202212393
|
| Extended DCC1 assay supplemented with MmpB-DH | yielded_reported_readout | No detected dehydration with added MmpB-DH | No dehydration reported in this supplied-domain context. Not a universal claim that the domain is inactive,that full-length parent lacks function,or that a particular native replacement enzyme was established. No rate or detection limit adopted. | DOI:10.1002/anie.202212393
|
Every edge carries its own citation; an uncited edge is refused by the corpus tests.
Causal graph — biosynthesis 19 nodes, 29 edges
Coupled MupQ/MupS starter assay, joint boiled control and lower-NADH partial-turnover readout. Candidate owner CHEBI:7025 denotes exact pseudomonic acid A, not the clinical mixture. Mixed-origin carrier/enzyme tests are methodological cross-compatibility evidence, not native thiomarinol or complete mupirocin biosynthesis. Supplement-only partial curation,not full-record sign-off.
| Subject | Predicate | Object | Notes | Evidence |
|---|---|---|---|---|
| Native NCIMB 10586 mupirocin locus | encodes_native_reference | Native MacpD sequence reference | AF318063.3 CDS63031..63351(+),1-based inclusive; AAM12933.1,106aa; native NCIMB 10586,taxon294. Exact CDS-aware table11 translation/GenPept/current UniProt match; current entry unreviewed,sequenceversion1. Native identity is not complete engineered assay-preparation identity. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| Native MacpD sequence reference | is_native_sequence_reference_for | Study holo-MacpD preparation | TableS1 body: C80A; full-length native reference does not identify this variant. Reported N-terminal extension: MHHHHHHGKPIPNPLLGLDSTENLYFQGIDPFT. FigureS10 associates C80A with structural studies. Do not infer the allele of every S5/S6 assay stock solely from the table; the graph uses the study preparation label. Apo characterization and holo/acylated reaction states are distinct. No native untagged proteoform asserted. | DOI:10.1021/acschembio.9b00969.s001
|
| Native NCIMB 10586 mupirocin locus | encodes_native_reference | Native MupQ sequence reference | AF318063.3 CDS60912..62267(+),1-based inclusive; AAM12931.1,451aa; native NCIMB 10586,taxon294. Exact CDS-aware table11 translation/GenPept/current UniProt match; current entry unreviewed,sequenceversion1. Native identity is not complete engineered assay-preparation identity. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| Native MupQ sequence reference | is_native_sequence_reference_for | Study MupQ preparation | TableS1 body: native body matches exactly; N-terminal tag remains engineered. Reported N-terminal extension: MAHHHHHHSSGLEVLFQGP. No native untagged proteoform asserted. | DOI:10.1021/acschembio.9b00969.s001
|
| Native NCIMB 10586 mupirocin locus | encodes_native_reference | Native MupS sequence reference | AF318063.3 CDS62264..63037(+),1-based inclusive; AAM12932.1,257aa; native NCIMB 10586,taxon294. Exact CDS-aware table11 translation/GenPept/current UniProt match; current entry unreviewed,sequenceversion1. Native identity is not complete engineered assay-preparation identity. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| Native MupS sequence reference | is_native_sequence_reference_for | Study MupS preparation | TableS1 body: native body matches exactly; N-terminal tag remains engineered. Reported N-terminal extension: MAHHHHHHSSGLEVLFQGP. No native untagged proteoform asserted. | DOI:10.1021/acschembio.9b00969.s001
|
| Study holo-MacpD preparation | was_component_in | S5A coupled starter-unit assay | S5A specifies holo-MacpD100uM,MupQ5uM,MupS5uM,malonyl-CoA1mM,ATP1mM,NADH1mM. These are assay concentrations,not kinetic constants; no unreported incubation details imported. | DOI:10.1021/acschembio.9b00969.s001
|
| Study MupQ preparation | was_component_in | S5A coupled starter-unit assay | S5A specifies holo-MacpD100uM,MupQ5uM,MupS5uM,malonyl-CoA1mM,ATP1mM,NADH1mM. These are assay concentrations,not kinetic constants; no unreported incubation details imported. | DOI:10.1021/acschembio.9b00969.s001
|
| Study MupS preparation | was_component_in | S5A coupled starter-unit assay | S5A specifies holo-MacpD100uM,MupQ5uM,MupS5uM,malonyl-CoA1mM,ATP1mM,NADH1mM. These are assay concentrations,not kinetic constants; no unreported incubation details imported. | DOI:10.1021/acschembio.9b00969.s001
|
| Supplied malonyl-CoA | was_component_in | S5A coupled starter-unit assay | S5A specifies holo-MacpD100uM,MupQ5uM,MupS5uM,malonyl-CoA1mM,ATP1mM,NADH1mM. These are assay concentrations,not kinetic constants; no unreported incubation details imported. | DOI:10.1021/acschembio.9b00969.s001
|
| Supplied ATP | was_component_in | S5A coupled starter-unit assay | S5A specifies holo-MacpD100uM,MupQ5uM,MupS5uM,malonyl-CoA1mM,ATP1mM,NADH1mM. These are assay concentrations,not kinetic constants; no unreported incubation details imported. | DOI:10.1021/acschembio.9b00969.s001
|
| Supplied NADH | was_component_in | S5A coupled starter-unit assay | S5A specifies holo-MacpD100uM,MupQ5uM,MupS5uM,malonyl-CoA1mM,ATP1mM,NADH1mM. These are assay concentrations,not kinetic constants; no unreported incubation details imported. | DOI:10.1021/acschembio.9b00969.s001
|
| S5A coupled starter-unit assay | yielded_source_assigned_product | Source-assigned 3-hydroxypropionyl-MacpD | Ppant-ejection mass spectrum supports the source's 3HP-MacpD assignment in the coupled mixture. This does not independently resolve every catalytic substep or establish native full-pathway flux. | DOI:10.1021/acschembio.9b00969.s001
|
| Study MupQ preparation | was_heat_treated_for | Boiled MupQ preparation | Both proteins were boiled in the same control; heat-treatment duration/temperature not adopted. | DOI:10.1021/acschembio.9b00969.s001
|
| Study MupS preparation | was_heat_treated_for | Boiled MupS preparation | Both proteins were boiled in the same control; heat-treatment duration/temperature not adopted. | DOI:10.1021/acschembio.9b00969.s001
|
| Study holo-MacpD preparation | was_component_in | S5B joint boiled-protein control | S5B repeats S5A with both MupQ and MupS boiled; not a separate single-protein omission test. | DOI:10.1021/acschembio.9b00969.s001
|
| Boiled MupQ preparation | was_component_in | S5B joint boiled-protein control | S5B repeats S5A with both MupQ and MupS boiled; not a separate single-protein omission test. | DOI:10.1021/acschembio.9b00969.s001
|
| Boiled MupS preparation | was_component_in | S5B joint boiled-protein control | S5B repeats S5A with both MupQ and MupS boiled; not a separate single-protein omission test. | DOI:10.1021/acschembio.9b00969.s001
|
| Supplied malonyl-CoA | was_component_in | S5B joint boiled-protein control | S5B repeats S5A with both MupQ and MupS boiled; not a separate single-protein omission test. | DOI:10.1021/acschembio.9b00969.s001
|
| Supplied ATP | was_component_in | S5B joint boiled-protein control | S5B repeats S5A with both MupQ and MupS boiled; not a separate single-protein omission test. | DOI:10.1021/acschembio.9b00969.s001
|
| Supplied NADH | was_component_in | S5B joint boiled-protein control | S5B repeats S5A with both MupQ and MupS boiled; not a separate single-protein omission test. | DOI:10.1021/acschembio.9b00969.s001
|
| S5B joint boiled-protein control | yielded_reported_readout | Holo-MacpD Ppant ion in boiled control | The ejected ion was assigned to unmodified holo-MacpD. No universal zero-activity or numerical detection limit inferred. | DOI:10.1021/acschembio.9b00969.s001
|
| Study holo-MacpD preparation | was_component_in | S5C-E lower-NADH assay | S5C lists MupQ5uM,MupS5uM and NADH100uM, sampled at60min. It does not restate all S5A components/concentrations; no complete ATP/ACP/malonyl-CoA recipe inferred for this condition. | DOI:10.1021/acschembio.9b00969.s001
|
| Study MupQ preparation | was_component_in | S5C-E lower-NADH assay | S5C lists MupQ5uM,MupS5uM and NADH100uM, sampled at60min. It does not restate all S5A components/concentrations; no complete ATP/ACP/malonyl-CoA recipe inferred for this condition. | DOI:10.1021/acschembio.9b00969.s001
|
| Study MupS preparation | was_component_in | S5C-E lower-NADH assay | S5C lists MupQ5uM,MupS5uM and NADH100uM, sampled at60min. It does not restate all S5A components/concentrations; no complete ATP/ACP/malonyl-CoA recipe inferred for this condition. | DOI:10.1021/acschembio.9b00969.s001
|
| Supplied malonyl-CoA | was_component_in | S5C-E lower-NADH assay | S5C lists MupQ5uM,MupS5uM and NADH100uM, sampled at60min. It does not restate all S5A components/concentrations; no complete ATP/ACP/malonyl-CoA recipe inferred for this condition. | DOI:10.1021/acschembio.9b00969.s001
|
| Supplied NADH | was_component_in | S5C-E lower-NADH assay | S5C lists MupQ5uM,MupS5uM and NADH100uM, sampled at60min. It does not restate all S5A components/concentrations; no complete ATP/ACP/malonyl-CoA recipe inferred for this condition. | DOI:10.1021/acschembio.9b00969.s001
|
| S5C-E lower-NADH assay | yielded_source_assigned_product | Source-assigned MacpD/CoA bis-thioester | S5D deconvolved mass was assigned to the unreduced MacpD/CoA bis-thioester. No numerical conversion yield adopted. | DOI:10.1021/acschembio.9b00969.s001
|
| S5C-E lower-NADH assay | yielded_source_assigned_product | Source-assigned MacpD malonic-semialdehyde species | S5D intact mass alone lacked resolution to distinguish partial from full reduction; S5E Ppant ejection supports the reported semialdehyde assignment. Do not present intact mass alone as decisive or claim purity. | DOI:10.1021/acschembio.9b00969.s001
|
Every edge carries its own citation; an uncited edge is refused by the corpus tests.
Causal graph — biosynthesis 17 nodes, 18 edges
Separate swapped-carrier adenylation/loading assays with enzyme-matched C3/C4 inputs. Candidate owner CHEBI:7025 denotes exact pseudomonic acid A, not the clinical mixture. Mixed-origin carrier/enzyme tests are methodological cross-compatibility evidence, not native thiomarinol or complete mupirocin biosynthesis. Supplement-only partial curation,not full-record sign-off.
| Subject | Predicate | Object | Notes | Evidence |
|---|---|---|---|---|
| Native NCIMB 10586 mupirocin locus | encodes_native_reference | Native MacpD sequence reference | AF318063.3 CDS63031..63351(+),1-based inclusive; AAM12933.1,106aa; native NCIMB 10586,taxon294. Exact CDS-aware table11 translation/GenPept/current UniProt match; current entry unreviewed,sequenceversion1. Native identity is not complete engineered assay-preparation identity. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| Native MacpD sequence reference | is_native_sequence_reference_for | Study holo-MacpD preparation | TableS1 body: C80A; full-length native reference does not identify this variant. Reported N-terminal extension: MHHHHHHGKPIPNPLLGLDSTENLYFQGIDPFT. FigureS10 associates C80A with structural studies. Do not infer the allele of every S5/S6 assay stock solely from the table; the graph uses the study preparation label. Apo characterization and holo/acylated reaction states are distinct. No native untagged proteoform asserted. | DOI:10.1021/acschembio.9b00969.s001
|
| Native SANK 73390 thiomarinol locus | encodes_native_reference | Native TacpD sequence reference | FN689524.1 CDS13493..13828(-),1-based inclusive; CBK62719.1,111aa; native SANK 73390,taxon747457,plasmid pTML1. Exact CDS-aware table11 translation/GenPept/UniParc sequence match. Legacy UniProt accession is deleted and not selected. Native identity is not complete engineered assay-preparation identity. | https://www.ncbi.nlm.nih.gov/nuccore/FN689524.1 |
| Native TacpD sequence reference | is_native_sequence_reference_for | Study holo-TacpD preparation | TableS1 body: native body matches exactly; N-terminal tag remains engineered. Reported N-terminal extension: AHHHHHHSSGLEVLFQGP. Apo characterization and holo/acylated reaction states are distinct. No native untagged proteoform asserted. | DOI:10.1021/acschembio.9b00969.s001
|
| Native NCIMB 10586 mupirocin locus | encodes_native_reference | Native MupQ sequence reference | AF318063.3 CDS60912..62267(+),1-based inclusive; AAM12931.1,451aa; native NCIMB 10586,taxon294. Exact CDS-aware table11 translation/GenPept/current UniProt match; current entry unreviewed,sequenceversion1. Native identity is not complete engineered assay-preparation identity. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| Native MupQ sequence reference | is_native_sequence_reference_for | Study MupQ preparation | TableS1 body: native body matches exactly; N-terminal tag remains engineered. Reported N-terminal extension: MAHHHHHHSSGLEVLFQGP. No native untagged proteoform asserted. | DOI:10.1021/acschembio.9b00969.s001
|
| Native SANK 73390 thiomarinol locus | encodes_native_reference | Native TmlQ sequence reference | FN689524.1 CDS14561..15898(-),1-based inclusive; CBK62721.1,445aa; native SANK 73390,taxon747457,plasmid pTML1. Exact CDS-aware table11 translation/GenPept/UniParc sequence match. Legacy UniProt accession is deleted and not selected. Native identity is not complete engineered assay-preparation identity. | https://www.ncbi.nlm.nih.gov/nuccore/FN689524.1 |
| Native TmlQ sequence reference | is_native_sequence_reference_for | Study TmlQ preparation | TableS1 body: native initiator M omitted from Table S1 body; Table S2 forward primer starts AAT. Reported N-terminal extension: AHHHHHHSSGLEVLFQGP. FigureS4 reports poor-quality MS with an 11Da error; it is not exact mass confirmation. No native untagged proteoform asserted. | DOI:10.1021/acschembio.9b00969.s001
|
| Study holo-MacpD preparation | was_component_in | MacpD/TmlQ mixed-origin assay | Cross-origin ACP/enzyme combination with the enzyme-matched CoA substrate. ATP is shown in the reaction scheme; complete concentrations/time and assay-stock variant are not independently verified. | DOI:10.1021/acschembio.9b00969.s001
|
| Study TmlQ preparation | was_component_in | MacpD/TmlQ mixed-origin assay | Cross-origin ACP/enzyme combination with the enzyme-matched CoA substrate. ATP is shown in the reaction scheme; complete concentrations/time and assay-stock variant are not independently verified. | DOI:10.1021/acschembio.9b00969.s001
|
| Supplied succinyl-CoA | was_component_in | MacpD/TmlQ mixed-origin assay | Cross-origin ACP/enzyme combination with the enzyme-matched CoA substrate. ATP is shown in the reaction scheme; complete concentrations/time and assay-stock variant are not independently verified. | DOI:10.1021/acschembio.9b00969.s001
|
| ATP in S6 reaction scheme | was_component_in | MacpD/TmlQ mixed-origin assay | Cross-origin ACP/enzyme combination with the enzyme-matched CoA substrate. ATP is shown in the reaction scheme; complete concentrations/time and assay-stock variant are not independently verified. | DOI:10.1021/acschembio.9b00969.s001
|
| MacpD/TmlQ mixed-origin assay | yielded_source_assigned_product | Source-assigned 4-carbon MacpD/CoA bis-thioester | ESMS envelope/deconvolved mass and the product schematic support the source bis-thioester assignment. This is not the reduced hydroxyacyl endpoint,ordinary ACP acylation,or native pathway reconstitution. | DOI:10.1021/acschembio.9b00969.s001
|
| Study holo-TacpD preparation | was_component_in | TacpD/MupQ mixed-origin assay | Cross-origin ACP/enzyme combination with the enzyme-matched CoA substrate. ATP is shown in the reaction scheme; complete concentrations/time and assay-stock variant are not independently verified. | DOI:10.1021/acschembio.9b00969.s001
|
| Study MupQ preparation | was_component_in | TacpD/MupQ mixed-origin assay | Cross-origin ACP/enzyme combination with the enzyme-matched CoA substrate. ATP is shown in the reaction scheme; complete concentrations/time and assay-stock variant are not independently verified. | DOI:10.1021/acschembio.9b00969.s001
|
| Supplied malonyl-CoA | was_component_in | TacpD/MupQ mixed-origin assay | Cross-origin ACP/enzyme combination with the enzyme-matched CoA substrate. ATP is shown in the reaction scheme; complete concentrations/time and assay-stock variant are not independently verified. | DOI:10.1021/acschembio.9b00969.s001
|
| ATP in S6 reaction scheme | was_component_in | TacpD/MupQ mixed-origin assay | Cross-origin ACP/enzyme combination with the enzyme-matched CoA substrate. ATP is shown in the reaction scheme; complete concentrations/time and assay-stock variant are not independently verified. | DOI:10.1021/acschembio.9b00969.s001
|
| TacpD/MupQ mixed-origin assay | yielded_source_assigned_product | Source-assigned 3-carbon TacpD/CoA bis-thioester | ESMS envelope/deconvolved mass and the product schematic support the source bis-thioester assignment. This is not the reduced hydroxyacyl endpoint,ordinary ACP acylation,or native pathway reconstitution. | DOI:10.1021/acschembio.9b00969.s001
|
Every edge carries its own citation; an uncited edge is refused by the corpus tests.
Causal graph — biosynthesis 16 nodes, 20 edges
TacpD-bound C3 reduction with TmlS and separately reported MupS substitution. Candidate owner CHEBI:7025 denotes exact pseudomonic acid A, not the clinical mixture. Mixed-origin carrier/enzyme tests are methodological cross-compatibility evidence, not native thiomarinol or complete mupirocin biosynthesis. Supplement-only partial curation,not full-record sign-off.
| Subject | Predicate | Object | Notes | Evidence |
|---|---|---|---|---|
| Native SANK 73390 thiomarinol locus | encodes_native_reference | Native TacpD sequence reference | FN689524.1 CDS13493..13828(-),1-based inclusive; CBK62719.1,111aa; native SANK 73390,taxon747457,plasmid pTML1. Exact CDS-aware table11 translation/GenPept/UniParc sequence match. Legacy UniProt accession is deleted and not selected. Native identity is not complete engineered assay-preparation identity. | https://www.ncbi.nlm.nih.gov/nuccore/FN689524.1 |
| Native TacpD sequence reference | is_native_sequence_reference_for | Study holo-TacpD preparation | TableS1 body: native body matches exactly; N-terminal tag remains engineered. Reported N-terminal extension: AHHHHHHSSGLEVLFQGP. Apo characterization and holo/acylated reaction states are distinct. No native untagged proteoform asserted. | DOI:10.1021/acschembio.9b00969.s001
|
| Native NCIMB 10586 mupirocin locus | encodes_native_reference | Native MupQ sequence reference | AF318063.3 CDS60912..62267(+),1-based inclusive; AAM12931.1,451aa; native NCIMB 10586,taxon294. Exact CDS-aware table11 translation/GenPept/current UniProt match; current entry unreviewed,sequenceversion1. Native identity is not complete engineered assay-preparation identity. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| Native MupQ sequence reference | is_native_sequence_reference_for | Study MupQ preparation | TableS1 body: native body matches exactly; N-terminal tag remains engineered. Reported N-terminal extension: MAHHHHHHSSGLEVLFQGP. No native untagged proteoform asserted. | DOI:10.1021/acschembio.9b00969.s001
|
| Native NCIMB 10586 mupirocin locus | encodes_native_reference | Native MupS sequence reference | AF318063.3 CDS62264..63037(+),1-based inclusive; AAM12932.1,257aa; native NCIMB 10586,taxon294. Exact CDS-aware table11 translation/GenPept/current UniProt match; current entry unreviewed,sequenceversion1. Native identity is not complete engineered assay-preparation identity. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| Native MupS sequence reference | is_native_sequence_reference_for | Study MupS preparation | TableS1 body: native body matches exactly; N-terminal tag remains engineered. Reported N-terminal extension: MAHHHHHHSSGLEVLFQGP. No native untagged proteoform asserted. | DOI:10.1021/acschembio.9b00969.s001
|
| Native SANK 73390 thiomarinol locus | encodes_native_reference | Native TmlS sequence reference | FN689524.1 CDS13822..14547(-),1-based inclusive; CBK62720.1,241aa; native SANK 73390,taxon747457,plasmid pTML1. Exact CDS-aware table11 translation/GenPept/UniParc sequence match. Legacy UniProt accession is deleted and not selected. Native identity is not complete engineered assay-preparation identity. | https://www.ncbi.nlm.nih.gov/nuccore/FN689524.1 |
| Native TmlS sequence reference | is_native_sequence_reference_for | Study TmlS preparation | TableS1 body: native body matches exactly; N-terminal tag remains engineered. Reported N-terminal extension: AHHHHHHSSGLEVLFQGP. No native untagged proteoform asserted. | DOI:10.1021/acschembio.9b00969.s001
|
| Study holo-TacpD preparation | was_component_in | TacpD/MupQ assay with TmlS | S8 caption lists TacpD,MupQ,malonyl-CoA,the named reductase and NADH. Complete ATP/concentration/time recipe is not supplied here and is not imported from another assay. | DOI:10.1021/acschembio.9b00969.s001
|
| Study MupQ preparation | was_component_in | TacpD/MupQ assay with TmlS | S8 caption lists TacpD,MupQ,malonyl-CoA,the named reductase and NADH. Complete ATP/concentration/time recipe is not supplied here and is not imported from another assay. | DOI:10.1021/acschembio.9b00969.s001
|
| Study TmlS preparation | was_component_in | TacpD/MupQ assay with TmlS | S8 caption lists TacpD,MupQ,malonyl-CoA,the named reductase and NADH. Complete ATP/concentration/time recipe is not supplied here and is not imported from another assay. | DOI:10.1021/acschembio.9b00969.s001
|
| Supplied malonyl-CoA | was_component_in | TacpD/MupQ assay with TmlS | S8 caption lists TacpD,MupQ,malonyl-CoA,the named reductase and NADH. Complete ATP/concentration/time recipe is not supplied here and is not imported from another assay. | DOI:10.1021/acschembio.9b00969.s001
|
| Supplied NADH | was_component_in | TacpD/MupQ assay with TmlS | S8 caption lists TacpD,MupQ,malonyl-CoA,the named reductase and NADH. Complete ATP/concentration/time recipe is not supplied here and is not imported from another assay. | DOI:10.1021/acschembio.9b00969.s001
|
| TacpD/MupQ assay with TmlS | yielded_source_assigned_product | Source-assigned 3-hydroxypropionyl-TacpD with TmlS | Displayed ESMS/deconvolved mass and Ppant-ejection spectrum support the 3HP-TacpD assignment. Mixed MupQ/TmlS combination does not establish native thiomarinol C4 starter synthesis. | DOI:10.1021/acschembio.9b00969.s001
|
| Study holo-TacpD preparation | was_component_in | TacpD/MupQ assay with MupS | S8 caption lists TacpD,MupQ,malonyl-CoA,the named reductase and NADH. Complete ATP/concentration/time recipe is not supplied here and is not imported from another assay. | DOI:10.1021/acschembio.9b00969.s001
|
| Study MupQ preparation | was_component_in | TacpD/MupQ assay with MupS | S8 caption lists TacpD,MupQ,malonyl-CoA,the named reductase and NADH. Complete ATP/concentration/time recipe is not supplied here and is not imported from another assay. | DOI:10.1021/acschembio.9b00969.s001
|
| Study MupS preparation | was_component_in | TacpD/MupQ assay with MupS | S8 caption lists TacpD,MupQ,malonyl-CoA,the named reductase and NADH. Complete ATP/concentration/time recipe is not supplied here and is not imported from another assay. | DOI:10.1021/acschembio.9b00969.s001
|
| Supplied malonyl-CoA | was_component_in | TacpD/MupQ assay with MupS | S8 caption lists TacpD,MupQ,malonyl-CoA,the named reductase and NADH. Complete ATP/concentration/time recipe is not supplied here and is not imported from another assay. | DOI:10.1021/acschembio.9b00969.s001
|
| Supplied NADH | was_component_in | TacpD/MupQ assay with MupS | S8 caption lists TacpD,MupQ,malonyl-CoA,the named reductase and NADH. Complete ATP/concentration/time recipe is not supplied here and is not imported from another assay. | DOI:10.1021/acschembio.9b00969.s001
|
| TacpD/MupQ assay with MupS | yielded_source_assigned_product | Source-assigned 3-hydroxypropionyl-TacpD with MupS | Caption reports the same result after MupS substitution,but those data are not shown; no separately inspected MupS spectrum or quantitative enzyme equivalence claimed. | DOI:10.1021/acschembio.9b00969.s001
|
Every edge carries its own citation; an uncited edge is refused by the corpus tests.
Causal graph — biosynthesis 22 nodes, 26 edges
Ordinary acyl transfer in A-carrier substitutions is distinct from productive D-carrier priming. Candidate owner CHEBI:7025 denotes exact pseudomonic acid A, not the clinical mixture. Mixed-origin carrier/enzyme tests are methodological cross-compatibility evidence, not native thiomarinol or complete mupirocin biosynthesis. Supplement-only partial curation,not full-record sign-off.
| Subject | Predicate | Object | Notes | Evidence |
|---|---|---|---|---|
| Native NCIMB 10586 mupirocin locus | encodes_native_reference | Native MacpA sequence reference | AF318063.3 CDS41870..42175(+),1-based inclusive; AAM12915.1,101aa; native NCIMB 10586,taxon294. Exact CDS-aware table11 translation/GenPept/current UniProt match; current entry unreviewed,sequenceversion1. Native identity is not complete engineered assay-preparation identity. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| Native MacpA sequence reference | is_native_sequence_reference_for | Study holo-MacpA preparation | TableS1 body: native body matches exactly; N-terminal tag remains engineered. Reported N-terminal extension: MAHHHHHHSSGLEVLFQGP. Apo characterization and holo/acylated reaction states are distinct. No native untagged proteoform asserted. | DOI:10.1021/acschembio.9b00969.s001
|
| Native SANK 73390 thiomarinol locus | encodes_native_reference | Native TacpA sequence reference | FN689524.1 CDS81681..81962(+),1-based inclusive; CBK62742.1,93aa; native SANK 73390,taxon747457,plasmid pTML1. Exact CDS-aware table11 translation/GenPept/UniParc sequence match. Legacy UniProt accession is deleted and not selected. Native identity is not complete engineered assay-preparation identity. | https://www.ncbi.nlm.nih.gov/nuccore/FN689524.1 |
| Native TacpA sequence reference | is_native_sequence_reference_for | Study holo-TacpA preparation | TableS1 body: native body matches exactly; N-terminal tag remains engineered. Reported N-terminal extension: MAHHHHHHSSGLEVLFQGP. Apo characterization and holo/acylated reaction states are distinct. No native untagged proteoform asserted. | DOI:10.1021/acschembio.9b00969.s001
|
| Native NCIMB 10586 mupirocin locus | encodes_native_reference | Native MupQ sequence reference | AF318063.3 CDS60912..62267(+),1-based inclusive; AAM12931.1,451aa; native NCIMB 10586,taxon294. Exact CDS-aware table11 translation/GenPept/current UniProt match; current entry unreviewed,sequenceversion1. Native identity is not complete engineered assay-preparation identity. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| Native MupQ sequence reference | is_native_sequence_reference_for | Study MupQ preparation | TableS1 body: native body matches exactly; N-terminal tag remains engineered. Reported N-terminal extension: MAHHHHHHSSGLEVLFQGP. No native untagged proteoform asserted. | DOI:10.1021/acschembio.9b00969.s001
|
| Native SANK 73390 thiomarinol locus | encodes_native_reference | Native TmlQ sequence reference | FN689524.1 CDS14561..15898(-),1-based inclusive; CBK62721.1,445aa; native SANK 73390,taxon747457,plasmid pTML1. Exact CDS-aware table11 translation/GenPept/UniParc sequence match. Legacy UniProt accession is deleted and not selected. Native identity is not complete engineered assay-preparation identity. | https://www.ncbi.nlm.nih.gov/nuccore/FN689524.1 |
| Native TmlQ sequence reference | is_native_sequence_reference_for | Study TmlQ preparation | TableS1 body: native initiator M omitted from Table S1 body; Table S2 forward primer starts AAT. Reported N-terminal extension: AHHHHHHSSGLEVLFQGP. FigureS4 reports poor-quality MS with an 11Da error; it is not exact mass confirmation. No native untagged proteoform asserted. | DOI:10.1021/acschembio.9b00969.s001
|
| Study holo-MacpA preparation | was_component_in | MacpA/MupQ carrier-substitution assay | The named ACP replaces the D-type carrier; complete ATP/concentration/time recipe not imported. | DOI:10.1021/acschembio.9b00969.s001
|
| Study MupQ preparation | was_component_in | MacpA/MupQ carrier-substitution assay | The named ACP replaces the D-type carrier; complete ATP/concentration/time recipe not imported. | DOI:10.1021/acschembio.9b00969.s001
|
| Supplied malonyl-CoA | was_component_in | MacpA/MupQ carrier-substitution assay | The named ACP replaces the D-type carrier; complete ATP/concentration/time recipe not imported. | DOI:10.1021/acschembio.9b00969.s001
|
| MacpA/MupQ carrier-substitution assay | yielded_reported_readout | Ppant readout assigned to malonyl-MacpA | Ppant ejection supports the ordinary acylated ACP assignment,not the D-carrier/CoA bis-thioester. The authors interpret trans-thioesterification rather than productive adenylation. No enzymatic catalysis by the added Q protein is established solely from coexistence in this reaction. | DOI:10.1021/acschembio.9b00969.s001
|
| MacpA/MupQ carrier-substitution assay | yielded_reported_readout | Acetyl-Ppant ion in MacpA malonyl assay | The source attributes this ion to decarboxylation during high-energy MS and notes enzyme-free observations not shown. It is not evidence for a biosynthetic decarboxylase reaction. | DOI:10.1021/acschembio.9b00969.s001
|
| Study holo-MacpA preparation | was_component_in | MacpA/TmlQ carrier-substitution assay | The named ACP replaces the D-type carrier; complete ATP/concentration/time recipe not imported. | DOI:10.1021/acschembio.9b00969.s001
|
| Study TmlQ preparation | was_component_in | MacpA/TmlQ carrier-substitution assay | The named ACP replaces the D-type carrier; complete ATP/concentration/time recipe not imported. | DOI:10.1021/acschembio.9b00969.s001
|
| Supplied succinyl-CoA | was_component_in | MacpA/TmlQ carrier-substitution assay | The named ACP replaces the D-type carrier; complete ATP/concentration/time recipe not imported. | DOI:10.1021/acschembio.9b00969.s001
|
| MacpA/TmlQ carrier-substitution assay | yielded_reported_readout | Ppant readout assigned to succinyl-MacpA | Ppant ejection supports the ordinary acylated ACP assignment,not the D-carrier/CoA bis-thioester. The authors interpret trans-thioesterification rather than productive adenylation. No enzymatic catalysis by the added Q protein is established solely from coexistence in this reaction. | DOI:10.1021/acschembio.9b00969.s001
|
| Study holo-TacpA preparation | was_component_in | TacpA/MupQ carrier-substitution assay | The named ACP replaces the D-type carrier; complete ATP/concentration/time recipe not imported. | DOI:10.1021/acschembio.9b00969.s001
|
| Study MupQ preparation | was_component_in | TacpA/MupQ carrier-substitution assay | The named ACP replaces the D-type carrier; complete ATP/concentration/time recipe not imported. | DOI:10.1021/acschembio.9b00969.s001
|
| Supplied malonyl-CoA | was_component_in | TacpA/MupQ carrier-substitution assay | The named ACP replaces the D-type carrier; complete ATP/concentration/time recipe not imported. | DOI:10.1021/acschembio.9b00969.s001
|
| TacpA/MupQ carrier-substitution assay | yielded_reported_readout | Ppant readout assigned to malonyl-TacpA | Ppant ejection supports the ordinary acylated ACP assignment,not the D-carrier/CoA bis-thioester. The authors interpret trans-thioesterification rather than productive adenylation. No enzymatic catalysis by the added Q protein is established solely from coexistence in this reaction. | DOI:10.1021/acschembio.9b00969.s001
|
| TacpA/MupQ carrier-substitution assay | yielded_reported_readout | Acetyl-Ppant ion in TacpA malonyl assay | The source attributes this ion to decarboxylation during high-energy MS and notes enzyme-free observations not shown. It is not evidence for a biosynthetic decarboxylase reaction. | DOI:10.1021/acschembio.9b00969.s001
|
| Study holo-TacpA preparation | was_component_in | TacpA/TmlQ carrier-substitution assay | The named ACP replaces the D-type carrier; complete ATP/concentration/time recipe not imported. | DOI:10.1021/acschembio.9b00969.s001
|
| Study TmlQ preparation | was_component_in | TacpA/TmlQ carrier-substitution assay | The named ACP replaces the D-type carrier; complete ATP/concentration/time recipe not imported. | DOI:10.1021/acschembio.9b00969.s001
|
| Supplied succinyl-CoA | was_component_in | TacpA/TmlQ carrier-substitution assay | The named ACP replaces the D-type carrier; complete ATP/concentration/time recipe not imported. | DOI:10.1021/acschembio.9b00969.s001
|
| TacpA/TmlQ carrier-substitution assay | yielded_reported_readout | Ppant readout assigned to succinyl-TacpA | Ppant ejection supports the ordinary acylated ACP assignment,not the D-carrier/CoA bis-thioester. The authors interpret trans-thioesterification rather than productive adenylation. No enzymatic catalysis by the added Q protein is established solely from coexistence in this reaction. | DOI:10.1021/acschembio.9b00969.s001
|
Every edge carries its own citation; an uncited edge is refused by the corpus tests.
Causal graph — biosynthesis 15 nodes, 20 edges
Native deletion phenotypes retain residual PAA and the source strain-label discrepancy. Exact-owner candidate CHEBI:7025 denotes pseudomonic acid A,not the clinical mixture. Native references,experimental preparations and source-assigned readouts are distinct. Substrate9 labels follow the beta-keto assay context; one synthesis sentence instead calls9 beta-hydroxy. That source inconsistency is retained,not a new chemical grounding. Partial main-text curation,not native pathway reconstitution,an established docking complex or full-record sign-off.
| Subject | Predicate | Object | Notes | Evidence |
|---|---|---|---|---|
| Native NCIMB 10586 mupirocin locus | encodes_native_reference | Native MupA sequence reference | AF318063.3 CDS600..1709(+),1-based inclusive; AAK28503.1,369aa. CDS-aware table11 translation matches original versioned GenPept and current UniProt. NCIMB10586,taxon294; unreviewed UniProt sequenceversion1. Native parent identity does not identify an engineered preparation or an excised domain. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| Reported mupA deletion allele | affects_coding_locus_of | Native MupA sequence reference | The experimental text names NCIMB10586,whereas Figure2 and the introduction name10585. Native reference follows the experimental text and audited NCIMB10586 deposit; the source strain discrepancy is retained. Deletion junctions,residual sequence and polar effects remain unverified. | DOI:10.1002/anie.202312514
|
| Reported mupA deletion allele | was_introduced_in | Study mupA-deletion producer culture | Producer genetic intervention,not an assay of isolated MupA. No complete strain-stock or complementation proof adopted from uninspected supporting information. | DOI:10.1002/anie.202312514
|
| Study mupA-deletion producer culture | yielded_source_assigned_metabolite | Source-assigned mupirocin A1 | The authors assign this minor isolated metabolite to the A1-A7 set lacking the6-hydroxy group. Exact individual structure,stereochemistry and quantitative titre are not re-grounded without supporting spectra. Not a direct substrate or product of purified MupA. | DOI:10.1002/anie.202312514
|
| Study wild-type producer culture | lacked_detected_metabolite | Source-assigned mupirocin A1 | Bounded absence from the reported wild-type extracts,not universal absence or a measured detection limit. | DOI:10.1002/anie.202312514
|
| Study mupA-deletion producer culture | yielded_source_assigned_metabolite | Source-assigned mupirocin A2 | The authors assign this minor isolated metabolite to the A1-A7 set lacking the6-hydroxy group. Exact individual structure,stereochemistry and quantitative titre are not re-grounded without supporting spectra. Not a direct substrate or product of purified MupA. | DOI:10.1002/anie.202312514
|
| Study wild-type producer culture | lacked_detected_metabolite | Source-assigned mupirocin A2 | Bounded absence from the reported wild-type extracts,not universal absence or a measured detection limit. | DOI:10.1002/anie.202312514
|
| Study mupA-deletion producer culture | yielded_source_assigned_metabolite | Source-assigned mupirocin A3 | The authors assign this minor isolated metabolite to the A1-A7 set lacking the6-hydroxy group. Exact individual structure,stereochemistry and quantitative titre are not re-grounded without supporting spectra. Not a direct substrate or product of purified MupA. | DOI:10.1002/anie.202312514
|
| Study wild-type producer culture | lacked_detected_metabolite | Source-assigned mupirocin A3 | Bounded absence from the reported wild-type extracts,not universal absence or a measured detection limit. | DOI:10.1002/anie.202312514
|
| Study mupA-deletion producer culture | yielded_source_assigned_metabolite | Source-assigned mupirocin A4 | The authors assign this minor isolated metabolite to the A1-A7 set lacking the6-hydroxy group. Exact individual structure,stereochemistry and quantitative titre are not re-grounded without supporting spectra. Not a direct substrate or product of purified MupA. | DOI:10.1002/anie.202312514
|
| Study wild-type producer culture | lacked_detected_metabolite | Source-assigned mupirocin A4 | Bounded absence from the reported wild-type extracts,not universal absence or a measured detection limit. | DOI:10.1002/anie.202312514
|
| Study mupA-deletion producer culture | yielded_source_assigned_metabolite | Source-assigned mupirocin A5 | The authors assign this minor isolated metabolite to the A1-A7 set lacking the6-hydroxy group. Exact individual structure,stereochemistry and quantitative titre are not re-grounded without supporting spectra. Not a direct substrate or product of purified MupA. | DOI:10.1002/anie.202312514
|
| Study wild-type producer culture | lacked_detected_metabolite | Source-assigned mupirocin A5 | Bounded absence from the reported wild-type extracts,not universal absence or a measured detection limit. | DOI:10.1002/anie.202312514
|
| Study mupA-deletion producer culture | yielded_source_assigned_metabolite | Source-assigned mupirocin A6 | The authors assign this minor isolated metabolite to the A1-A7 set lacking the6-hydroxy group. Exact individual structure,stereochemistry and quantitative titre are not re-grounded without supporting spectra. Not a direct substrate or product of purified MupA. | DOI:10.1002/anie.202312514
|
| Study wild-type producer culture | lacked_detected_metabolite | Source-assigned mupirocin A6 | Bounded absence from the reported wild-type extracts,not universal absence or a measured detection limit. | DOI:10.1002/anie.202312514
|
| Study mupA-deletion producer culture | yielded_source_assigned_metabolite | Source-assigned mupirocin A7 | The authors assign this minor isolated metabolite to the A1-A7 set lacking the6-hydroxy group. Exact individual structure,stereochemistry and quantitative titre are not re-grounded without supporting spectra. Not a direct substrate or product of purified MupA. | DOI:10.1002/anie.202312514
|
| Study wild-type producer culture | lacked_detected_metabolite | Source-assigned mupirocin A7 | Bounded absence from the reported wild-type extracts,not universal absence or a measured detection limit. | DOI:10.1002/anie.202312514
|
| Study mupA-deletion producer culture | retained_detected_production_of | Source-assigned pseudomonic acid A | Low residual PAA was reported across replicates; do not say production was abolished. Compensation by another enzyme is a hypothesis,not identification of a particular homolog. | DOI:10.1002/anie.202312514
|
| Study mupA-deletion producer culture | yielded_source_assigned_metabolite | Source-assigned mupiric acid | Curtailed C8 extract-product assignment,not purified-enzyme turnover or quantified flux. | DOI:10.1002/anie.202312514
|
| Study mupA-deletion producer culture | lacked_detected_metabolite | Source-assigned mupirocin H | Bounded extract nondetection,not a universal biosynthetic exclusion. | DOI:10.1002/anie.202312514
|
Every edge carries its own citation; an uncited edge is refused by the corpus tests.
Causal graph — biosynthesis 14 nodes, 16 edges
Three distinct NMR pairs,without converting an interaction screen into catalytic evidence. Exact-owner candidate CHEBI:7025 denotes pseudomonic acid A,not the clinical mixture. Native references,experimental preparations and source-assigned readouts are distinct. Substrate9 labels follow the beta-keto assay context; one synthesis sentence instead calls9 beta-hydroxy. That source inconsistency is retained,not a new chemical grounding. Partial main-text curation,not native pathway reconstitution,an established docking complex or full-record sign-off.
| Subject | Predicate | Object | Notes | Evidence |
|---|---|---|---|---|
| Native NCIMB 10586 mupirocin locus | encodes_native_reference | Native MupA sequence reference | AF318063.3 CDS600..1709(+),1-based inclusive; AAK28503.1,369aa. CDS-aware table11 translation matches original versioned GenPept and current UniProt. NCIMB10586,taxon294; unreviewed UniProt sequenceversion1. Native parent identity does not identify an engineered preparation or an excised domain. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| Native NCIMB 10586 mupirocin locus | encodes_native_reference | Native MmpD sequence reference | AF318063.3 CDS20958..40526(+),1-based inclusive; AAM12913.2,6522aa. CDS-aware table11 translation matches original versioned GenPept and current UniProt. NCIMB10586,taxon294; unreviewed UniProt sequenceversion2. Native parent identity does not identify an engineered preparation or an excised domain. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| Native NCIMB 10586 mupirocin locus | encodes_native_reference | Native MmpA sequence reference | AF318063.3 CDS1706..10243(+),1-based inclusive; AAM12909.2,2845aa. CDS-aware table11 translation matches original versioned GenPept and current UniProt. NCIMB10586,taxon294; unreviewed UniProt sequenceversion2. Native parent identity does not identify an engineered preparation or an excised domain. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| Native MupA sequence reference | is_native_parent_sequence_reference_for | Study purified MupA preparation | Gene-matched reference,not a complete tagged construct or native-cell proteoform. Concentration-dependent SEC observations do not establish native oligomer stoichiometry here. | DOI:10.1002/anie.202312514
|
| Native MmpD sequence reference | is_native_parent_sequence_reference_for | Study 15N-labelled apo-ACP_D4 preparation | Individually excised ACP from the native parent,not an independent gene product. Complete domain boundaries,tagged sequence and isotope incorporation remain unverified. | DOI:10.1002/anie.202312514
|
| Native MmpA sequence reference | is_native_parent_sequence_reference_for | Study 15N-labelled apo-ACP_A1 preparation | Individually excised ACP from the native parent,not an independent gene product. Complete domain boundaries,tagged sequence and isotope incorporation remain unverified. | DOI:10.1002/anie.202312514
|
| Native MmpA sequence reference | is_native_parent_sequence_reference_for | Study excised MmpA KS0 preparation | Main text specifies native residues28..570,including a docking flank. This543aa native segment is identical in AAM12909.1 and AAM12909.2,although the full parent sequences differ. Not full-length MmpA or complete engineered/tagged stock identity; supporting sequence details and exact structural domain boundaries were not inspected. | DOI:10.1002/anie.202312514 |
| Study 15N-labelled apo-ACP_D4 preparation | was_component_in | MupA/ACP_D4 HSQC titration | Named NMR titration; no quantitative affinity,stoichiometric complex or catalytic turnover follows from inclusion in this measurement. | DOI:10.1002/anie.202312514
|
| Study purified MupA preparation | was_component_in | MupA/ACP_D4 HSQC titration | Named NMR titration; no quantitative affinity,stoichiometric complex or catalytic turnover follows from inclusion in this measurement. | DOI:10.1002/anie.202312514
|
| MupA/ACP_D4 HSQC titration | yielded_reported_readout | Reported MupA/ACP_D4 NMR response | Qualitative line-broadening/HSQC response supports possible interaction,not a quantitative affinity ranking or a solved stable native assembly. ACP_A1 interaction with MupA does not imply hydroxylation of its attached substrate. No MupA/KS0 pair is inferred from these separate titrations. | DOI:10.1002/anie.202312514
|
| Study 15N-labelled apo-ACP_A1 preparation | was_component_in | MupA/ACP_A1 HSQC titration | Named NMR titration; no quantitative affinity,stoichiometric complex or catalytic turnover follows from inclusion in this measurement. | DOI:10.1002/anie.202312514
|
| Study purified MupA preparation | was_component_in | MupA/ACP_A1 HSQC titration | Named NMR titration; no quantitative affinity,stoichiometric complex or catalytic turnover follows from inclusion in this measurement. | DOI:10.1002/anie.202312514
|
| MupA/ACP_A1 HSQC titration | yielded_reported_readout | Reported MupA/ACP_A1 NMR response | Qualitative line-broadening/HSQC response supports possible interaction,not a quantitative affinity ranking or a solved stable native assembly. ACP_A1 interaction with MupA does not imply hydroxylation of its attached substrate. No MupA/KS0 pair is inferred from these separate titrations. | DOI:10.1002/anie.202312514
|
| Study 15N-labelled apo-ACP_D4 preparation | was_component_in | MmpA-KS0/ACP_D4 HSQC titration | Named NMR titration; no quantitative affinity,stoichiometric complex or catalytic turnover follows from inclusion in this measurement. | DOI:10.1002/anie.202312514
|
| Study excised MmpA KS0 preparation | was_component_in | MmpA-KS0/ACP_D4 HSQC titration | Named NMR titration; no quantitative affinity,stoichiometric complex or catalytic turnover follows from inclusion in this measurement. | DOI:10.1002/anie.202312514
|
| MmpA-KS0/ACP_D4 HSQC titration | yielded_reported_readout | Reported MmpA-KS0/ACP_D4 NMR response | Qualitative line-broadening/HSQC response supports possible interaction,not a quantitative affinity ranking or a solved stable native assembly. ACP_A1 interaction with MupA does not imply hydroxylation of its attached substrate. No MupA/KS0 pair is inferred from these separate titrations. | DOI:10.1002/anie.202312514
|
Every edge carries its own citation; an uncited edge is refused by the corpus tests.
Causal graph — biosynthesis 27 nodes, 39 edges
Separate ACP-bound substrate and negative-control assays with a deliberately nonnative Fre surrogate. Exact-owner candidate CHEBI:7025 denotes pseudomonic acid A,not the clinical mixture. Native references,experimental preparations and source-assigned readouts are distinct. Substrate9 labels follow the beta-keto assay context; one synthesis sentence instead calls9 beta-hydroxy. That source inconsistency is retained,not a new chemical grounding. Partial main-text curation,not native pathway reconstitution,an established docking complex or full-record sign-off.
| Subject | Predicate | Object | Notes | Evidence |
|---|---|---|---|---|
| Native NCIMB 10586 mupirocin locus | encodes_native_reference | Native MupA sequence reference | AF318063.3 CDS600..1709(+),1-based inclusive; AAK28503.1,369aa. CDS-aware table11 translation matches original versioned GenPept and current UniProt. NCIMB10586,taxon294; unreviewed UniProt sequenceversion1. Native parent identity does not identify an engineered preparation or an excised domain. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| Native NCIMB 10586 mupirocin locus | encodes_native_reference | Native MmpD sequence reference | AF318063.3 CDS20958..40526(+),1-based inclusive; AAM12913.2,6522aa. CDS-aware table11 translation matches original versioned GenPept and current UniProt. NCIMB10586,taxon294; unreviewed UniProt sequenceversion2. Native parent identity does not identify an engineered preparation or an excised domain. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| Native NCIMB 10586 mupirocin locus | encodes_native_reference | Native MmpA sequence reference | AF318063.3 CDS1706..10243(+),1-based inclusive; AAM12909.2,2845aa. CDS-aware table11 translation matches original versioned GenPept and current UniProt. NCIMB10586,taxon294; unreviewed UniProt sequenceversion2. Native parent identity does not identify an engineered preparation or an excised domain. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| E. coli K-12 Fre native sequence reference | is_sequence_reference_for_surrogate | Study surrogate Fre preparation | Paper explicitly selects GenBank M61182 as a surrogate reductase. M61182.1 CDS121..822(+), AAA23806.1,233aa; CDS-aware table11 translation/GenPept/current UniProt match. Deposit taxon562 has a K-12 strain qualifier; UniProt taxon83333 denotes K12,not the same taxon ID. Reviewed UniProt sequenceversion2. Not a native mupirocin-cluster reductase,complete tagged stock,or automatic identity with preparations in other publications. | https://www.ncbi.nlm.nih.gov/nuccore/M61182.1 |
| Native MupA sequence reference | is_native_parent_sequence_reference_for | Study purified MupA preparation | Gene-matched reference,not a complete tagged construct or native-cell proteoform. Concentration-dependent SEC observations do not establish native oligomer stoichiometry here. | DOI:10.1002/anie.202312514
|
| Native MmpD sequence reference | is_native_carrier_parent_reference_for | Synthetic beta-keto substrate9 on ACP_D4 | Acylated or holo excised domain,not complete parent protein or an independent native gene product. Acyl state and complete engineered sequence identity remain distinct. | DOI:10.1002/anie.202312514
|
| Study purified MupA preparation | was_component_in | Study synthetic beta-keto substrate9 on ACP_D4 MupA assay | Purified coupled assay with named components; no individual-component sufficiency or unreported concentrations/time inferred. | DOI:10.1002/anie.202312514
|
| Synthetic beta-keto substrate9 on ACP_D4 | was_component_in | Study synthetic beta-keto substrate9 on ACP_D4 MupA assay | Purified coupled assay with named components; no individual-component sufficiency or unreported concentrations/time inferred. | DOI:10.1002/anie.202312514
|
| Study surrogate Fre preparation | was_component_in | Study synthetic beta-keto substrate9 on ACP_D4 MupA assay | Purified coupled assay with named components; no individual-component sufficiency or unreported concentrations/time inferred. | DOI:10.1002/anie.202312514
|
| Supplied FMN | was_component_in | Study synthetic beta-keto substrate9 on ACP_D4 MupA assay | Purified coupled assay with named components; no individual-component sufficiency or unreported concentrations/time inferred. | DOI:10.1002/anie.202312514
|
| Supplied NADH | was_component_in | Study synthetic beta-keto substrate9 on ACP_D4 MupA assay | Purified coupled assay with named components; no individual-component sufficiency or unreported concentrations/time inferred. | DOI:10.1002/anie.202312514
|
| Native MmpD sequence reference | is_native_carrier_parent_reference_for | Source-assigned hydroxylated10-ACP_D4 | Source-assigned chemically modified excised ACP_D4,not the native full parent. | DOI:10.1002/anie.202312514
|
| Study synthetic beta-keto substrate9 on ACP_D4 MupA assay | yielded_source_assigned_product | Source-assigned hydroxylated10-ACP_D4 | Intact-protein MS and Ppant ejection support oxygen addition on the tethered substrate,not just the carrier body. Product instability,hydrolysis and an unidentified carrier-body-modification byproduct preclude a purity or exclusive selectivity claim. Alpha-site interpretation also uses the separate isotope/MS study. | DOI:10.1002/anie.202312514
|
| Native MmpA sequence reference | is_native_carrier_parent_reference_for | Synthetic beta-keto substrate9 on ACP_A1 | Acylated or holo excised domain,not complete parent protein or an independent native gene product. Acyl state and complete engineered sequence identity remain distinct. | DOI:10.1002/anie.202312514
|
| Study purified MupA preparation | was_component_in | Study synthetic beta-keto substrate9 on ACP_A1 MupA assay | Purified coupled assay with named components; no individual-component sufficiency or unreported concentrations/time inferred. | DOI:10.1002/anie.202312514
|
| Synthetic beta-keto substrate9 on ACP_A1 | was_component_in | Study synthetic beta-keto substrate9 on ACP_A1 MupA assay | Purified coupled assay with named components; no individual-component sufficiency or unreported concentrations/time inferred. | DOI:10.1002/anie.202312514
|
| Study surrogate Fre preparation | was_component_in | Study synthetic beta-keto substrate9 on ACP_A1 MupA assay | Purified coupled assay with named components; no individual-component sufficiency or unreported concentrations/time inferred. | DOI:10.1002/anie.202312514
|
| Supplied FMN | was_component_in | Study synthetic beta-keto substrate9 on ACP_A1 MupA assay | Purified coupled assay with named components; no individual-component sufficiency or unreported concentrations/time inferred. | DOI:10.1002/anie.202312514
|
| Supplied NADH | was_component_in | Study synthetic beta-keto substrate9 on ACP_A1 MupA assay | Purified coupled assay with named components; no individual-component sufficiency or unreported concentrations/time inferred. | DOI:10.1002/anie.202312514
|
| Study synthetic beta-keto substrate9 on ACP_A1 MupA assay | yielded_reported_readout | No reported hydroxylation with synthetic beta-keto substrate9 on ACP_A1 | Bounded reported nondetection,not universal enzyme inactivity or native pathway exclusion. NMR interaction with MupA did not yield detected hydroxylation on this carrier. | DOI:10.1002/anie.202312514
|
| Native MmpD sequence reference | is_native_carrier_parent_reference_for | Synthetic beta-hydroxy substrate12 on ACP_D4 | Acylated or holo excised domain,not complete parent protein or an independent native gene product. Acyl state and complete engineered sequence identity remain distinct. | DOI:10.1002/anie.202312514
|
| Study purified MupA preparation | was_component_in | Study synthetic beta-hydroxy substrate12 on ACP_D4 MupA assay | Purified coupled assay with named components; no individual-component sufficiency or unreported concentrations/time inferred. | DOI:10.1002/anie.202312514
|
| Synthetic beta-hydroxy substrate12 on ACP_D4 | was_component_in | Study synthetic beta-hydroxy substrate12 on ACP_D4 MupA assay | Purified coupled assay with named components; no individual-component sufficiency or unreported concentrations/time inferred. | DOI:10.1002/anie.202312514
|
| Study surrogate Fre preparation | was_component_in | Study synthetic beta-hydroxy substrate12 on ACP_D4 MupA assay | Purified coupled assay with named components; no individual-component sufficiency or unreported concentrations/time inferred. | DOI:10.1002/anie.202312514
|
| Supplied FMN | was_component_in | Study synthetic beta-hydroxy substrate12 on ACP_D4 MupA assay | Purified coupled assay with named components; no individual-component sufficiency or unreported concentrations/time inferred. | DOI:10.1002/anie.202312514
|
| Supplied NADH | was_component_in | Study synthetic beta-hydroxy substrate12 on ACP_D4 MupA assay | Purified coupled assay with named components; no individual-component sufficiency or unreported concentrations/time inferred. | DOI:10.1002/anie.202312514
|
| Study synthetic beta-hydroxy substrate12 on ACP_D4 MupA assay | yielded_reported_readout | No reported hydroxylation with synthetic beta-hydroxy substrate12 on ACP_D4 | Bounded reported nondetection,not universal enzyme inactivity or native pathway exclusion. | DOI:10.1002/anie.202312514
|
| Native MmpA sequence reference | is_native_carrier_parent_reference_for | Synthetic beta-hydroxy substrate12 on ACP_A1 | Acylated or holo excised domain,not complete parent protein or an independent native gene product. Acyl state and complete engineered sequence identity remain distinct. | DOI:10.1002/anie.202312514
|
| Study purified MupA preparation | was_component_in | Study synthetic beta-hydroxy substrate12 on ACP_A1 MupA assay | Bounded main-text control/substitution report. The complete cofactor/reductase recipe is not restated here and is not imported from a separate assay. | DOI:10.1002/anie.202312514
|
| Synthetic beta-hydroxy substrate12 on ACP_A1 | was_component_in | Study synthetic beta-hydroxy substrate12 on ACP_A1 MupA assay | Bounded main-text control/substitution report. The complete cofactor/reductase recipe is not restated here and is not imported from a separate assay. | DOI:10.1002/anie.202312514
|
| Study synthetic beta-hydroxy substrate12 on ACP_A1 MupA assay | yielded_reported_readout | No reported hydroxylation with synthetic beta-hydroxy substrate12 on ACP_A1 | Bounded reported nondetection,not universal enzyme inactivity or native pathway exclusion. The main text explicitly says these data are not shown; no control spectrum inspected. | DOI:10.1002/anie.202312514
|
| Native MmpD sequence reference | is_native_carrier_parent_reference_for | Unacylated holo-ACP_D4 | Acylated or holo excised domain,not complete parent protein or an independent native gene product. Acyl state and complete engineered sequence identity remain distinct. | DOI:10.1002/anie.202312514
|
| Study purified MupA preparation | was_component_in | Study unacylated holo-ACP_D4 MupA assay | Bounded main-text control/substitution report. The complete cofactor/reductase recipe is not restated here and is not imported from a separate assay. | DOI:10.1002/anie.202312514
|
| Unacylated holo-ACP_D4 | was_component_in | Study unacylated holo-ACP_D4 MupA assay | Bounded main-text control/substitution report. The complete cofactor/reductase recipe is not restated here and is not imported from a separate assay. | DOI:10.1002/anie.202312514
|
| Study unacylated holo-ACP_D4 MupA assay | yielded_reported_readout | No reported hydroxylation with unacylated holo-ACP_D4 | Bounded reported nondetection,not universal enzyme inactivity or native pathway exclusion. | DOI:10.1002/anie.202312514
|
| Native MmpD sequence reference | is_native_carrier_parent_reference_for | Acetoacetyl-ACP_D4 substitute | Acylated or holo excised domain,not complete parent protein or an independent native gene product. Acyl state and complete engineered sequence identity remain distinct. | DOI:10.1002/anie.202312514
|
| Study purified MupA preparation | was_component_in | Study acetoacetyl-ACP_D4 substitute MupA assay | Bounded main-text control/substitution report. The complete cofactor/reductase recipe is not restated here and is not imported from a separate assay. | DOI:10.1002/anie.202312514
|
| Acetoacetyl-ACP_D4 substitute | was_component_in | Study acetoacetyl-ACP_D4 substitute MupA assay | Bounded main-text control/substitution report. The complete cofactor/reductase recipe is not restated here and is not imported from a separate assay. | DOI:10.1002/anie.202312514
|
| Study acetoacetyl-ACP_D4 substitute MupA assay | yielded_reported_readout | No reported hydroxylation with acetoacetyl-ACP_D4 substitute | Bounded reported nondetection,not universal enzyme inactivity or native pathway exclusion. The main text explicitly says these data are not shown; no control spectrum inspected. | DOI:10.1002/anie.202312514
|
Every edge carries its own citation; an uncited edge is refused by the corpus tests.
Causal graph — biosynthesis 17 nodes, 17 edges
Whole-cell and purified free-substrate tests remain separate negative contexts. Exact-owner candidate CHEBI:7025 denotes pseudomonic acid A,not the clinical mixture. Native references,experimental preparations and source-assigned readouts are distinct. Substrate9 labels follow the beta-keto assay context; one synthesis sentence instead calls9 beta-hydroxy. That source inconsistency is retained,not a new chemical grounding. Partial main-text curation,not native pathway reconstitution,an established docking complex or full-record sign-off.
| Subject | Predicate | Object | Notes | Evidence |
|---|---|---|---|---|
| Native NCIMB 10586 mupirocin locus | encodes_native_reference | Native MupA sequence reference | AF318063.3 CDS600..1709(+),1-based inclusive; AAK28503.1,369aa. CDS-aware table11 translation matches original versioned GenPept and current UniProt. NCIMB10586,taxon294; unreviewed UniProt sequenceversion1. Native parent identity does not identify an engineered preparation or an excised domain. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| E. coli K-12 Fre native sequence reference | is_sequence_reference_for_surrogate | Study surrogate Fre preparation | Paper explicitly selects GenBank M61182 as a surrogate reductase. M61182.1 CDS121..822(+), AAA23806.1,233aa; CDS-aware table11 translation/GenPept/current UniProt match. Deposit taxon562 has a K-12 strain qualifier; UniProt taxon83333 denotes K12,not the same taxon ID. Reviewed UniProt sequenceversion2. Not a native mupirocin-cluster reductase,complete tagged stock,or automatic identity with preparations in other publications. | https://www.ncbi.nlm.nih.gov/nuccore/M61182.1 |
| Native MupA sequence reference | is_native_parent_sequence_reference_for | Study purified MupA preparation | Gene-matched reference,not a complete tagged construct or native-cell proteoform. Concentration-dependent SEC observations do not establish native oligomer stoichiometry here. | DOI:10.1002/anie.202312514
|
| Native MupA sequence reference | is_sequence_reference_for_heterologous_expression | Study live E. coli culture overexpressing MupA | Source reports MupA overexpression in E. coli. Complete host strain,vector,expressed proteoform and enzyme abundance remain unverified; the culture is not the purified preparation. | DOI:10.1002/anie.202312514
|
| Study live E. coli culture overexpressing MupA | was_component_in | Whole-cell thioester9 feeding | Named components only; no unreported complete recipe,enzyme sufficiency or concentration imported. For substrate12 the text describes equivalent biotransformation tests but does not independently restate glucose supplementation or all conditions. | DOI:10.1002/anie.202312514
|
| Supplied glucose | was_component_in | Whole-cell thioester9 feeding | Named components only; no unreported complete recipe,enzyme sufficiency or concentration imported. For substrate12 the text describes equivalent biotransformation tests but does not independently restate glucose supplementation or all conditions. | DOI:10.1002/anie.202312514
|
| Synthetic free beta-keto pantetheine thioester9 | was_component_in | Whole-cell thioester9 feeding | Named components only; no unreported complete recipe,enzyme sufficiency or concentration imported. For substrate12 the text describes equivalent biotransformation tests but does not independently restate glucose supplementation or all conditions. | DOI:10.1002/anie.202312514
|
| Whole-cell thioester9 feeding | yielded_reported_readout | No detected conversion in Whole-cell thioester9 feeding | Bounded reported negative result,not proof that an untethered substrate can never react. Trace starting material and hydrolysed thioester were recovered; uptake and instability are not resolved. | DOI:10.1002/anie.202312514
|
| Study purified MupA preparation | was_component_in | Purified free-thioester9 assay | Named components only; no unreported complete recipe,enzyme sufficiency or concentration imported. For substrate12 the text describes equivalent biotransformation tests but does not independently restate glucose supplementation or all conditions. | DOI:10.1002/anie.202312514
|
| Study surrogate Fre preparation | was_component_in | Purified free-thioester9 assay | Named components only; no unreported complete recipe,enzyme sufficiency or concentration imported. For substrate12 the text describes equivalent biotransformation tests but does not independently restate glucose supplementation or all conditions. | DOI:10.1002/anie.202312514
|
| Supplied FMN | was_component_in | Purified free-thioester9 assay | Named components only; no unreported complete recipe,enzyme sufficiency or concentration imported. For substrate12 the text describes equivalent biotransformation tests but does not independently restate glucose supplementation or all conditions. | DOI:10.1002/anie.202312514
|
| Supplied NADH | was_component_in | Purified free-thioester9 assay | Named components only; no unreported complete recipe,enzyme sufficiency or concentration imported. For substrate12 the text describes equivalent biotransformation tests but does not independently restate glucose supplementation or all conditions. | DOI:10.1002/anie.202312514
|
| Synthetic free beta-keto pantetheine thioester9 | was_component_in | Purified free-thioester9 assay | Named components only; no unreported complete recipe,enzyme sufficiency or concentration imported. For substrate12 the text describes equivalent biotransformation tests but does not independently restate glucose supplementation or all conditions. | DOI:10.1002/anie.202312514
|
| Purified free-thioester9 assay | yielded_reported_readout | No detected conversion in Purified free-thioester9 assay | Bounded reported negative result,not proof that an untethered substrate can never react. LCMS assigned the observed peak to starting material,not a newly hydroxylated product. | DOI:10.1002/anie.202312514
|
| Study live E. coli culture overexpressing MupA | was_component_in | Reported whole-cell substrate12 test | Named components only; no unreported complete recipe,enzyme sufficiency or concentration imported. For substrate12 the text describes equivalent biotransformation tests but does not independently restate glucose supplementation or all conditions. | DOI:10.1002/anie.202312514
|
| Synthetic free beta-hydroxy substrate12 | was_component_in | Reported whole-cell substrate12 test | Named components only; no unreported complete recipe,enzyme sufficiency or concentration imported. For substrate12 the text describes equivalent biotransformation tests but does not independently restate glucose supplementation or all conditions. | DOI:10.1002/anie.202312514
|
| Reported whole-cell substrate12 test | yielded_reported_readout | No detected conversion in Reported whole-cell substrate12 test | Bounded reported negative result,not proof that an untethered substrate can never react. Data are explicitly not shown; no substrate12 whole-cell chromatogram inspected. | DOI:10.1002/anie.202312514
|
Every edge carries its own citation; an uncited edge is refused by the corpus tests.
Causal graph — biosynthesis 18 nodes, 25 edges
Isotope NMR depletion and parallel MS evidence retain the missing transient-product resonance. Exact-owner candidate CHEBI:7025 denotes pseudomonic acid A,not the clinical mixture. Native references,experimental preparations and source-assigned readouts are distinct. Substrate9 labels follow the beta-keto assay context; one synthesis sentence instead calls9 beta-hydroxy. That source inconsistency is retained,not a new chemical grounding. Partial main-text curation,not native pathway reconstitution,an established docking complex or full-record sign-off.
| Subject | Predicate | Object | Notes | Evidence |
|---|---|---|---|---|
| Native NCIMB 10586 mupirocin locus | encodes_native_reference | Native MupA sequence reference | AF318063.3 CDS600..1709(+),1-based inclusive; AAK28503.1,369aa. CDS-aware table11 translation matches original versioned GenPept and current UniProt. NCIMB10586,taxon294; unreviewed UniProt sequenceversion1. Native parent identity does not identify an engineered preparation or an excised domain. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| Native NCIMB 10586 mupirocin locus | encodes_native_reference | Native MmpD sequence reference | AF318063.3 CDS20958..40526(+),1-based inclusive; AAM12913.2,6522aa. CDS-aware table11 translation matches original versioned GenPept and current UniProt. NCIMB10586,taxon294; unreviewed UniProt sequenceversion2. Native parent identity does not identify an engineered preparation or an excised domain. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| E. coli K-12 Fre native sequence reference | is_sequence_reference_for_surrogate | Study surrogate Fre preparation | Paper explicitly selects GenBank M61182 as a surrogate reductase. M61182.1 CDS121..822(+), AAA23806.1,233aa; CDS-aware table11 translation/GenPept/current UniProt match. Deposit taxon562 has a K-12 strain qualifier; UniProt taxon83333 denotes K12,not the same taxon ID. Reviewed UniProt sequenceversion2. Not a native mupirocin-cluster reductase,complete tagged stock,or automatic identity with preparations in other publications. | https://www.ncbi.nlm.nih.gov/nuccore/M61182.1 |
| Native MupA sequence reference | is_native_parent_sequence_reference_for | Study purified MupA preparation | Gene-matched reference,not a complete tagged construct or native-cell proteoform. Concentration-dependent SEC observations do not establish native oligomer stoichiometry here. | DOI:10.1002/anie.202312514
|
| Native MmpD sequence reference | is_native_carrier_parent_reference_for | Study alpha-13C substrate9-ACP_D4 | Excised ACP_D4 with isotope-labelled tethered substrate,not isotope incorporation into the native parent sequence or a complete engineered-stock identity. | DOI:10.1002/anie.202312514
|
| Study alpha-13C substrate9-ACP_D4 | was_component_in | Labelled-substrate NMR control without MupA | Figure4 control lacks MupA. Reported recipe is distinct from unspecified controls in other assays. | DOI:10.1002/anie.202312514
|
| Study surrogate Fre preparation | was_component_in | Labelled-substrate NMR control without MupA | Figure4 control lacks MupA. Reported recipe is distinct from unspecified controls in other assays. | DOI:10.1002/anie.202312514
|
| Supplied FMN | was_component_in | Labelled-substrate NMR control without MupA | Figure4 control lacks MupA. Reported recipe is distinct from unspecified controls in other assays. | DOI:10.1002/anie.202312514
|
| Supplied NADH | was_component_in | Labelled-substrate NMR control without MupA | Figure4 control lacks MupA. Reported recipe is distinct from unspecified controls in other assays. | DOI:10.1002/anie.202312514
|
| Study alpha-13C substrate9-ACP_D4 | was_component_in | Labelled-substrate NMR mixture with MupA | Reported SO-FAST HSQC mixture; no numerical kinetics or individual Fre sufficiency claimed. | DOI:10.1002/anie.202312514
|
| Study surrogate Fre preparation | was_component_in | Labelled-substrate NMR mixture with MupA | Reported SO-FAST HSQC mixture; no numerical kinetics or individual Fre sufficiency claimed. | DOI:10.1002/anie.202312514
|
| Supplied FMN | was_component_in | Labelled-substrate NMR mixture with MupA | Reported SO-FAST HSQC mixture; no numerical kinetics or individual Fre sufficiency claimed. | DOI:10.1002/anie.202312514
|
| Supplied NADH | was_component_in | Labelled-substrate NMR mixture with MupA | Reported SO-FAST HSQC mixture; no numerical kinetics or individual Fre sufficiency claimed. | DOI:10.1002/anie.202312514
|
| Study purified MupA preparation | was_component_in | Labelled-substrate NMR mixture with MupA | Reported SO-FAST HSQC mixture; no numerical kinetics or individual Fre sufficiency claimed. | DOI:10.1002/anie.202312514
|
| Study alpha-13C substrate9-ACP_D4 | was_component_in | Parallel labelled-substrate ESMS assay | Parallel mass-spectrometric measurement reported alongside NMR,not identity of individual molecules or aliquots across detection methods. | DOI:10.1002/anie.202312514
|
| Study surrogate Fre preparation | was_component_in | Parallel labelled-substrate ESMS assay | Parallel mass-spectrometric measurement reported alongside NMR,not identity of individual molecules or aliquots across detection methods. | DOI:10.1002/anie.202312514
|
| Supplied FMN | was_component_in | Parallel labelled-substrate ESMS assay | Parallel mass-spectrometric measurement reported alongside NMR,not identity of individual molecules or aliquots across detection methods. | DOI:10.1002/anie.202312514
|
| Supplied NADH | was_component_in | Parallel labelled-substrate ESMS assay | Parallel mass-spectrometric measurement reported alongside NMR,not identity of individual molecules or aliquots across detection methods. | DOI:10.1002/anie.202312514
|
| Study purified MupA preparation | was_component_in | Parallel labelled-substrate ESMS assay | Parallel mass-spectrometric measurement reported alongside NMR,not identity of individual molecules or aliquots across detection methods. | DOI:10.1002/anie.202312514
|
| Labelled-substrate NMR control without MupA | yielded_reported_readout | Control bound-substrate and hydrolysed-substrate resonances | Source assigns separate resonances to ACP-bound and hydrolysed labelled substrate. No exact integration ratio or quantitative flux adopted. | DOI:10.1002/anie.202312514
|
| Labelled-substrate NMR mixture with MupA | yielded_reported_readout | Loss of bound-substrate alpha-carbon signal with MupA | Addition of MupA depleted the labelled bound-substrate signal; signal loss alone is not a directly resolved hydroxylated-carbon resonance. | DOI:10.1002/anie.202312514
|
| Labelled-substrate NMR mixture with MupA | yielded_reported_readout | Hydrolysed-substrate signal intensity remained unchanged | No corresponding depletion of the source-assigned free hydrolysed moiety was reported; bounded comparison,not universal nonreactivity. | DOI:10.1002/anie.202312514
|
| Labelled-substrate NMR mixture with MupA | yielded_reported_readout | Reported NADH-to-NAD+ NMR change | Cofactor conversion was followed in the coupled mixture; no separate enzyme-specific redox stoichiometry or turnover rate inferred. | DOI:10.1002/anie.202312514
|
| Labelled-substrate NMR mixture with MupA | yielded_reported_readout | Transient hydroxylated alpha-13C signal not detected | The predicted hydroxylated-carbon resonance was not directly observed. Masking by water was an explanation,not a measured alternative peak. | DOI:10.1002/anie.202312514
|
| Parallel labelled-substrate ESMS assay | yielded_reported_readout | Parallel MS/Ppant readout assigned to hydroxylation | Parallel ESMS/Ppant supported hydroxylation while NMR tracked substrate depletion; the convergent interpretation must not be rewritten as direct detection of the transient hydroxylated-carbon NMR signal. | DOI:10.1002/anie.202312514
|
Every edge carries its own citation; an uncited edge is refused by the corpus tests.
Causal graph — biosynthesis 10 nodes, 13 edges
KS0 loading with two oxidation states of the beta carbon; transfer of an alpha-hydroxylated intermediate remains unresolved. Exact-owner candidate CHEBI:7025 denotes pseudomonic acid A,not the clinical mixture. Native references,experimental preparations and source-assigned readouts are distinct. Substrate9 labels follow the beta-keto assay context; one synthesis sentence instead calls9 beta-hydroxy. That source inconsistency is retained,not a new chemical grounding. Partial main-text curation,not native pathway reconstitution,an established docking complex or full-record sign-off.
| Subject | Predicate | Object | Notes | Evidence |
|---|---|---|---|---|
| Native NCIMB 10586 mupirocin locus | encodes_native_reference | Native MmpD sequence reference | AF318063.3 CDS20958..40526(+),1-based inclusive; AAM12913.2,6522aa. CDS-aware table11 translation matches original versioned GenPept and current UniProt. NCIMB10586,taxon294; unreviewed UniProt sequenceversion2. Native parent identity does not identify an engineered preparation or an excised domain. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| Native NCIMB 10586 mupirocin locus | encodes_native_reference | Native MmpA sequence reference | AF318063.3 CDS1706..10243(+),1-based inclusive; AAM12909.2,2845aa. CDS-aware table11 translation matches original versioned GenPept and current UniProt. NCIMB10586,taxon294; unreviewed UniProt sequenceversion2. Native parent identity does not identify an engineered preparation or an excised domain. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| Native MmpA sequence reference | is_native_parent_sequence_reference_for | Study excised MmpA KS0 preparation | Main text specifies native residues28..570,including a docking flank. This543aa native segment is identical in AAM12909.1 and AAM12909.2,although the full parent sequences differ. Not full-length MmpA or complete engineered/tagged stock identity; supporting sequence details and exact structural domain boundaries were not inspected. | DOI:10.1002/anie.202312514 |
| Native MmpD sequence reference | is_native_carrier_parent_reference_for | Study beta-keto substrate9-ACP_D4 donor | Acyl-loaded excised ACP_D4,not the full native parent or a free pantetheine substrate. | DOI:10.1002/anie.202312514
|
| Native MmpA sequence reference | is_native_parent_sequence_reference_for | Source-assigned substrate9-loaded MmpA-KS0 | Source-assigned acylated excised KS0 preparation,not full-length MmpA or native in-cell occupancy. | DOI:10.1002/anie.202312514
|
| Study beta-keto substrate9-ACP_D4 donor | was_component_in | Excised MmpA-KS0 substrate9 transfer assay | Purified-domain transfer assay; no downstream ACP loading,chain extension or native full-pathway flux inferred. | DOI:10.1002/anie.202312514
|
| Study excised MmpA KS0 preparation | was_component_in | Excised MmpA-KS0 substrate9 transfer assay | Purified-domain transfer assay; no downstream ACP loading,chain extension or native full-pathway flux inferred. | DOI:10.1002/anie.202312514
|
| Excised MmpA-KS0 substrate9 transfer assay | yielded_source_assigned_product | Source-assigned substrate9-loaded MmpA-KS0 | The authors assign an ESMS species to acyl transfer. Reported observed mass increments do not exactly match calculated increments; no exact-mass confirmation or numerical conversion/rate adopted. This tests a non-alpha-hydroxylated substrate,not the unstable alpha-hydroxylated intermediate. | DOI:10.1002/anie.202312514
|
| Native MmpD sequence reference | is_native_carrier_parent_reference_for | Study beta-hydroxy substrate12-ACP_D4 donor | Acyl-loaded excised ACP_D4,not the full native parent or a free pantetheine substrate. | DOI:10.1002/anie.202312514
|
| Native MmpA sequence reference | is_native_parent_sequence_reference_for | Source-assigned substrate12-loaded MmpA-KS0 | Source-assigned acylated excised KS0 preparation,not full-length MmpA or native in-cell occupancy. | DOI:10.1002/anie.202312514
|
| Study beta-hydroxy substrate12-ACP_D4 donor | was_component_in | Excised MmpA-KS0 substrate12 transfer assay | Purified-domain transfer assay; no downstream ACP loading,chain extension or native full-pathway flux inferred. | DOI:10.1002/anie.202312514
|
| Study excised MmpA KS0 preparation | was_component_in | Excised MmpA-KS0 substrate12 transfer assay | Purified-domain transfer assay; no downstream ACP loading,chain extension or native full-pathway flux inferred. | DOI:10.1002/anie.202312514
|
| Excised MmpA-KS0 substrate12 transfer assay | yielded_source_assigned_product | Source-assigned substrate12-loaded MmpA-KS0 | The authors assign an ESMS species to acyl transfer. Reported observed mass increments do not exactly match calculated increments; no exact-mass confirmation or numerical conversion/rate adopted. This tests a non-alpha-hydroxylated substrate,not the unstable alpha-hydroxylated intermediate. | DOI:10.1002/anie.202312514
|
Every edge carries its own citation; an uncited edge is refused by the corpus tests.
Causal graph — biosynthesis 11 nodes, 11 edges
Single and double mutant product assignments. Owner CHEBI:7025 denotes pseudomonic acid A, not the clinical mixture. Desepoxy feeding outcomes concern the parallel PA-C branch; PA-C is not this owner's structure. Native references, engineered genotypes, source-assigned metabolites and mechanistic proposals remain distinct. No purified-enzyme turnover, complete pathway reconstitution or full-record sign-off.
| Subject | Predicate | Object | Notes | Evidence |
|---|---|---|---|---|
| Native NCIMB 10586 mupirocin locus | encodes_native_reference | Native MupP sequence reference | AF318063.3 CDS 59935..60864(+), 1-based inclusive; AAM12930.2, 309 aa. NCIMB 10586, taxon 294; unreviewed UniProt sequence version 2. CDS-aware table-11 translation matches GenPept and UniProt. Native reference, not an expressed full-length protein in a deletion strain or a complete engineered allele. Rejected A0ACD4XY39: same gene label and species taxon but different 223 aa phosphatase sequence, CP140009/WQD73931.1; a name match does not establish cluster identity. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| Native NCIMB 10586 mupirocin locus | encodes_native_reference | Native MmpE sequence reference | AF318063.3 CDS 49802..53377(+), 1-based inclusive; AAM12925.2, 1191 aa. NCIMB 10586, taxon 294; unreviewed UniProt sequence version 2. CDS-aware table-11 translation matches GenPept and UniProt. Native reference, not an expressed full-length protein in a deletion strain or a complete engineered allele. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| Single-mutant mupP deletion | affects_coding_locus_of | Native MupP sequence reference | Native reference anchors the affected locus. Deletion junctions, residual sequence and possible polar effects are unverified; not a claim that the intact enzyme remains present. | DOI:10.1002/anie.201611590
|
| Single-mutant mupP deletion | was_present_in | Study NCIMB 10586 mupP-deletion culture | Reported engineered genotype; complete stock and expression state not established. | DOI:10.1002/anie.201611590
|
| Double-mutant mupP deletion | affects_coding_locus_of | Native MupP sequence reference | Native reference anchors the affected locus. Deletion junctions, residual sequence and possible polar effects are unverified; not a claim that the intact enzyme remains present. | DOI:10.1002/anie.201611590
|
| Double-mutant mupP deletion | was_present_in | Study NCIMB 10586 mmpE-OR/mupP double-deletion culture | Reported engineered genotype; complete stock and expression state not established. | DOI:10.1002/anie.201611590
|
| Reported deletion of MmpE OR domain | affects_coding_locus_of | Native MmpE sequence reference | Native reference anchors the affected locus. Deletion junctions, residual sequence and possible polar effects are unverified; not a claim that the intact enzyme remains present. | DOI:10.1002/anie.201611590
|
| Reported deletion of MmpE OR domain | was_present_in | Study NCIMB 10586 mmpE-OR/mupP double-deletion culture | Reported engineered genotype; complete stock and expression state not established. | DOI:10.1002/anie.201611590
|
| Study NCIMB 10586 mupP-deletion culture | yielded_source_assigned_metabolite | Source-assigned mupirocin P (13) | Unstable major MW 514 metabolite; fractionation and NMR support the source assignment. | DOI:10.1002/anie.201611590
|
| Study NCIMB 10586 mmpE-OR/mupP double-deletion culture | yielded_major_source_assigned_metabolite | Source-assigned desepoxy-mupirocin P (16) | Crude-extract HPLC Figure 2 and isolation account; no numerical yield or replicate precision adopted. | DOI:10.1002/anie.201611590
|
| Study NCIMB 10586 mmpE-OR/mupP double-deletion culture | yielded_minor_source_assigned_metabolite | Source-assigned desepoxy-PA-B (17) | Source reports a small accompanying amount; not a universal production ratio. | DOI:10.1002/anie.201611590
|
Every edge carries its own citation; an uncited edge is refused by the corpus tests.
Causal graph — biosynthesis 13 nodes, 15 edges
Two culture contexts retain separate evidentiary detail. Owner CHEBI:7025 denotes pseudomonic acid A, not the clinical mixture. Desepoxy feeding outcomes concern the parallel PA-C branch; PA-C is not this owner's structure. Native references, engineered genotypes, source-assigned metabolites and mechanistic proposals remain distinct. No purified-enzyme turnover, complete pathway reconstitution or full-record sign-off.
| Subject | Predicate | Object | Notes | Evidence |
|---|---|---|---|---|
| Native NCIMB 10586 mupirocin locus | encodes_native_reference | Native MmpE sequence reference | AF318063.3 CDS 49802..53377(+), 1-based inclusive; AAM12925.2, 1191 aa. NCIMB 10586, taxon 294; unreviewed UniProt sequence version 2. CDS-aware table-11 translation matches GenPept and UniProt. Native reference, not an expressed full-length protein in a deletion strain or a complete engineered allele. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| Native NCIMB 10586 mupirocin locus | encodes_native_reference | Native MupW sequence reference | AF318063.3 CDS 70055..71446(+), 1-based inclusive; AAM12939.1, 463 aa. NCIMB 10586, taxon 294; unreviewed UniProt sequence version 1. CDS-aware table-11 translation matches GenPept and UniProt. Native reference, not an expressed full-length protein in a deletion strain or a complete engineered allele. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| Native NCIMB 10586 mupirocin locus | encodes_native_reference | Native MupV sequence reference | AF318063.3 CDS 68027..70015(+), 1-based inclusive; AAM12938.1, 662 aa. NCIMB 10586, taxon 294; unreviewed UniProt sequence version 1. CDS-aware table-11 translation matches GenPept and UniProt. Native reference, not an expressed full-length protein in a deletion strain or a complete engineered allele. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| Reported deletion of MmpE OR domain | affects_coding_locus_of | Native MmpE sequence reference | Native reference anchors the affected locus. Deletion junctions, residual sequence and possible polar effects are unverified; not a claim that the intact enzyme remains present. | DOI:10.1002/anie.201611590
|
| Reported deletion of MmpE OR domain | was_present_in | Study mmpE-OR/mupW double-deletion culture | Reported engineered genotype; complete stock and expression state not established. | DOI:10.1002/anie.201611590
|
| Reported mupW deletion | affects_coding_locus_of | Native MupW sequence reference | Native reference anchors the affected locus. Deletion junctions, residual sequence and possible polar effects are unverified; not a claim that the intact enzyme remains present. | DOI:10.1002/anie.201611590
|
| Reported mupW deletion | was_present_in | Study mmpE-OR/mupW double-deletion culture | Reported engineered genotype; complete stock and expression state not established. | DOI:10.1002/anie.201611590
|
| Reported mupV deletion | affects_coding_locus_of | Native MupV sequence reference | Native reference anchors the affected locus. Deletion junctions, residual sequence and possible polar effects are unverified; not a claim that the intact enzyme remains present. | DOI:10.1002/anie.201611590
|
| Reported mupV deletion | was_present_in | Study mupV-deletion culture | Reported engineered genotype; complete stock and expression state not established. | DOI:10.1002/anie.201611590
|
| Study mmpE-OR/mupW double-deletion culture | was_culture_in | Desepoxy-P (16) feeding to mmpE-OR/mupW mutant | Separate reported whole-culture feeding context. | DOI:10.1002/anie.201611590
|
| Fed source-assigned desepoxy-mupirocin P (16) | was_supplied_to | Desepoxy-P (16) feeding to mmpE-OR/mupW mutant | Not an isolated-enzyme substrate assay. | DOI:10.1002/anie.201611590
|
| Desepoxy-P (16) feeding to mmpE-OR/mupW mutant | yielded_source_assigned_product | Source-assigned PA-C (9) feeding product | LCMS MW 484 peak followed by isolation/NMR assignment. | DOI:10.1002/anie.201611590
|
| Study mupV-deletion culture | was_culture_in | Desepoxy-P (16) feeding to mupV mutant | Separate reported whole-culture feeding context. | DOI:10.1002/anie.201611590
|
| Fed source-assigned desepoxy-mupirocin P (16) | was_supplied_to | Desepoxy-P (16) feeding to mupV mutant | Not an isolated-enzyme substrate assay. | DOI:10.1002/anie.201611590
|
| Desepoxy-P (16) feeding to mupV mutant | yielded_source_assigned_product | Source-assigned PA-C (9) feeding product | Main text and Scheme 2 report PA-C; the separate isolation/NMR description is not restated for this host. | DOI:10.1002/anie.201611590
|
Every edge carries its own citation; an uncited edge is refused by the corpus tests.
Causal graph — biosynthesis 7 nodes, 7 edges
Inferred reaction and ordering remain explicitly proposed. Owner CHEBI:7025 denotes pseudomonic acid A, not the clinical mixture. Desepoxy feeding outcomes concern the parallel PA-C branch; PA-C is not this owner's structure. Native references, engineered genotypes, source-assigned metabolites and mechanistic proposals remain distinct. No purified-enzyme turnover, complete pathway reconstitution or full-record sign-off.
| Subject | Predicate | Object | Notes | Evidence |
|---|---|---|---|---|
| Native NCIMB 10586 mupirocin locus | encodes_native_reference | Native MupP sequence reference | AF318063.3 CDS 59935..60864(+), 1-based inclusive; AAM12930.2, 309 aa. NCIMB 10586, taxon 294; unreviewed UniProt sequence version 2. CDS-aware table-11 translation matches GenPept and UniProt. Native reference, not an expressed full-length protein in a deletion strain or a complete engineered allele. Rejected A0ACD4XY39: same gene label and species taxon but different 223 aa phosphatase sequence, CP140009/WQD73931.1; a name match does not establish cluster identity. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| Native NCIMB 10586 mupirocin locus | encodes_native_reference | Native MupV sequence reference | AF318063.3 CDS 68027..70015(+), 1-based inclusive; AAM12938.1, 662 aa. NCIMB 10586, taxon 294; unreviewed UniProt sequence version 1. CDS-aware table-11 translation matches GenPept and UniProt. Native reference, not an expressed full-length protein in a deletion strain or a complete engineered allele. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| Native MupP sequence reference | is_proposed_to_catalyze | Proposed mupirocin-P (13) dehydration | Genetic/metabolite interpretation; no isolated MupP turnover is reported here. | DOI:10.1002/anie.201611590
|
| Source-assigned mupirocin P (13) | is_proposed_substrate_of | Proposed mupirocin-P (13) dehydration | Scheme 1 proposal. | DOI:10.1002/anie.201611590
|
| Proposed mupirocin-P (13) dehydration | is_proposed_to_yield | Proposed enol-ketone mupirocin C1 (14) product | Scheme 1 proposal, not a purified-enzyme product assay. | DOI:10.1002/anie.201611590
|
| Native MupV sequence reference | is_proposed_to_act_before | Native MupP sequence reference | Order inferred from mutant feeding, not a demonstrated protein interaction or timed catalytic sequence. | DOI:10.1002/anie.201611590
|
| Native MupV sequence reference | has_proposed_unresolved_function | Unresolved MupV hydrolysis or carrier-transfer role | Sequence comparison suggests alternatives; neither chemistry is directly established by the feeding result. | DOI:10.1002/anie.201611590
|
Every edge carries its own citation; an uncited edge is refused by the corpus tests.
Causal graph — biosynthesis 11 nodes, 10 edges
Separate MupC and MupF genetic observations and proposed roles. Native sequence examples and reported genetic interventions are distinct. Abstract-bounded evidence does not establish exact historical stocks, purified-enzyme sufficiency, quantitative flux or a stable complex. Owner CHEBI:7025 denotes PA-A, not the clinical mixture; other source-assigned metabolites remain distinct. Not full-record sign-off.
| Subject | Predicate | Object | Notes | Evidence |
|---|---|---|---|---|
| NCIMB 10586 reference mupirocin locus | encodes_native_reference_example | MupC native sequence example (NCIMB 10586) | AF318063.3 CDS 40523..41818(+), 1-based inclusive; AAM12914.1, 431 aa. Native deposit strain NCIMB 10586, taxon 294. CDS-aware table-11 translation exactly matches GenPept and UniProt; unreviewed sequence version 1. Deliberately selected gene-matched pathway reference, not confirmed identity with the historical experimental strain, intact protein or deletion allele. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| NCIMB 10586 reference mupirocin locus | encodes_native_reference_example | MupF native sequence example (NCIMB 10586) | AF318063.3 CDS 44334..45344(-), 1-based inclusive; AAM12919.1, 336 aa. Native deposit strain NCIMB 10586, taxon 294. CDS-aware table-11 translation exactly matches GenPept and UniProt; unreviewed sequence version 1. Deliberately selected gene-matched pathway reference, not confirmed identity with the historical experimental strain, intact protein or deletion allele. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| mupC in-frame deletion (single-mutant context) | has_gene_matched_native_reference_example | MupC native sequence example (NCIMB 10586) | Locus-name correspondence only; no equality of stock sequences or retained intact protein asserted. | DOI:10.1074/jbc.M701490200
|
| mupC in-frame deletion (single-mutant context) | was_present_in | Study P. fluorescens mupC mutant culture | Reported mutant context; deletion junctions and polar effects unverified. | DOI:10.1074/jbc.M701490200
|
| Study P. fluorescens mupC mutant culture | yielded_source_assigned_analogue | Source-assigned mupC-mutant analogue | Reported genetic-metabolite observation; not a purified-protein reaction product. | DOI:10.1074/jbc.M701490200
|
| MupC native sequence example (NCIMB 10586) | has_proposed_function | Proposed THP-ring oxidation-state contribution | Inferred from the reported phenotype and putative annotation, not an isolated-enzyme assay. | DOI:10.1074/jbc.M701490200
|
| mupF in-frame deletion (single-mutant context) | has_gene_matched_native_reference_example | MupF native sequence example (NCIMB 10586) | Locus-name correspondence only; no equality of stock sequences or retained intact protein asserted. | DOI:10.1074/jbc.M701490200
|
| mupF in-frame deletion (single-mutant context) | was_present_in | Study P. fluorescens mupF mutant culture | Reported mutant context; deletion junctions and polar effects unverified. | DOI:10.1074/jbc.M701490200
|
| Study P. fluorescens mupF mutant culture | yielded_source_assigned_analogue | Source-assigned C-7-ketone analogue | Reported genetic-metabolite observation; not a purified-protein reaction product. | DOI:10.1074/jbc.M701490200
|
| MupF native sequence example (NCIMB 10586) | has_proposed_function | Proposed C-7 ketoreduction | Inferred from the reported phenotype and putative annotation, not an isolated-enzyme assay. | DOI:10.1074/jbc.M701490200
|
Every edge carries its own citation; an uncited edge is refused by the corpus tests.
Causal graph — biosynthesis 15 nodes, 20 edges
Four single-mutant contexts preserve PA-B versus PA-A outcomes. Native sequence examples and reported genetic interventions are distinct. Abstract-bounded evidence does not establish exact historical stocks, purified-enzyme sufficiency, quantitative flux or a stable complex. Owner CHEBI:7025 denotes PA-A, not the clinical mixture; other source-assigned metabolites remain distinct. Not full-record sign-off.
| Subject | Predicate | Object | Notes | Evidence |
|---|---|---|---|---|
| NCIMB 10586 reference mupirocin locus | encodes_native_reference_example | MupO native sequence example (NCIMB 10586) | AF318063.3 CDS 58574..59938(+), 1-based inclusive; AAM12929.2, 454 aa. Native deposit strain NCIMB 10586, taxon 294. CDS-aware table-11 translation exactly matches GenPept and UniProt; unreviewed sequence version 2. Deliberately selected gene-matched pathway reference, not confirmed identity with the historical experimental strain, intact protein or deletion allele. AAM12929.2 replaced version1 in 2014, after the cited experiment. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| NCIMB 10586 reference mupirocin locus | encodes_native_reference_example | MupU native sequence example (NCIMB 10586) | AF318063.3 CDS 66415..67992(+), 1-based inclusive; AAM12937.1, 525 aa. Native deposit strain NCIMB 10586, taxon 294. CDS-aware table-11 translation exactly matches GenPept and UniProt; unreviewed sequence version 1. Deliberately selected gene-matched pathway reference, not confirmed identity with the historical experimental strain, intact protein or deletion allele. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| NCIMB 10586 reference mupirocin locus | encodes_native_reference_example | MupV native sequence example (NCIMB 10586) | AF318063.3 CDS 68027..70015(+), 1-based inclusive; AAM12938.1, 662 aa. Native deposit strain NCIMB 10586, taxon 294. CDS-aware table-11 translation exactly matches GenPept and UniProt; unreviewed sequence version 1. Deliberately selected gene-matched pathway reference, not confirmed identity with the historical experimental strain, intact protein or deletion allele. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| NCIMB 10586 reference mupirocin locus | encodes_native_reference_example | MacpE native sequence example (NCIMB 10586) | AF318063.3 CDS 65730..65972(+), 1-based inclusive; AAM12935.1, 80 aa. Native deposit strain NCIMB 10586, taxon 294. CDS-aware table-11 translation exactly matches GenPept and UniProt; unreviewed sequence version 1. Deliberately selected gene-matched pathway reference, not confirmed identity with the historical experimental strain, intact protein or deletion allele. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| mupO in-frame deletion (single-mutant context) | has_gene_matched_native_reference_example | MupO native sequence example (NCIMB 10586) | Locus-name correspondence only; no equality of stock sequences or retained intact protein asserted. | DOI:10.1074/jbc.M701490200
|
| mupO in-frame deletion (single-mutant context) | was_present_in | Study P. fluorescens mupO mutant culture | Reported mutant context; deletion junctions and polar effects unverified. | DOI:10.1074/jbc.M701490200
|
| Study P. fluorescens mupO mutant culture | retained_reported_production_of | Source-assigned pseudomonic acid B | Bounded culture-product report. | DOI:10.1074/jbc.M701490200
|
| Study P. fluorescens mupO mutant culture | lacked_reported_production_of | Source-assigned pseudomonic acid A | Reported absence, not a measured zero or universal inability to produce PA-A. | DOI:10.1074/jbc.M701490200
|
| mupU in-frame deletion (single-mutant context) | has_gene_matched_native_reference_example | MupU native sequence example (NCIMB 10586) | Locus-name correspondence only; no equality of stock sequences or retained intact protein asserted. | DOI:10.1074/jbc.M701490200
|
| mupU in-frame deletion (single-mutant context) | was_present_in | Study P. fluorescens mupU mutant culture | Reported mutant context; deletion junctions and polar effects unverified. | DOI:10.1074/jbc.M701490200
|
| Study P. fluorescens mupU mutant culture | retained_reported_production_of | Source-assigned pseudomonic acid B | Bounded culture-product report. | DOI:10.1074/jbc.M701490200
|
| Study P. fluorescens mupU mutant culture | lacked_reported_production_of | Source-assigned pseudomonic acid A | Reported absence, not a measured zero or universal inability to produce PA-A. | DOI:10.1074/jbc.M701490200
|
| mupV in-frame deletion (single-mutant context) | has_gene_matched_native_reference_example | MupV native sequence example (NCIMB 10586) | Locus-name correspondence only; no equality of stock sequences or retained intact protein asserted. | DOI:10.1074/jbc.M701490200
|
| mupV in-frame deletion (single-mutant context) | was_present_in | Study P. fluorescens mupV mutant culture | Reported mutant context; deletion junctions and polar effects unverified. | DOI:10.1074/jbc.M701490200
|
| Study P. fluorescens mupV mutant culture | retained_reported_production_of | Source-assigned pseudomonic acid B | Bounded culture-product report. | DOI:10.1074/jbc.M701490200
|
| Study P. fluorescens mupV mutant culture | lacked_reported_production_of | Source-assigned pseudomonic acid A | Reported absence, not a measured zero or universal inability to produce PA-A. | DOI:10.1074/jbc.M701490200
|
| macpE in-frame deletion (single-mutant context) | has_gene_matched_native_reference_example | MacpE native sequence example (NCIMB 10586) | Locus-name correspondence only; no equality of stock sequences or retained intact protein asserted. | DOI:10.1074/jbc.M701490200
|
| macpE in-frame deletion (single-mutant context) | was_present_in | Study P. fluorescens macpE mutant culture | Reported mutant context; deletion junctions and polar effects unverified. | DOI:10.1074/jbc.M701490200
|
| Study P. fluorescens macpE mutant culture | retained_reported_production_of | Source-assigned pseudomonic acid B | Bounded culture-product report. | DOI:10.1074/jbc.M701490200
|
| Study P. fluorescens macpE mutant culture | lacked_reported_production_of | Source-assigned pseudomonic acid A | Reported absence, not a measured zero or universal inability to produce PA-A. | DOI:10.1074/jbc.M701490200
|
Every edge carries its own citation; an uncited edge is refused by the corpus tests.
Causal graph — biosynthesis 20 nodes, 32 edges
Four double mutants and three explicitly inferred ordering relationships. Native sequence examples and reported genetic interventions are distinct. Abstract-bounded evidence does not establish exact historical stocks, purified-enzyme sufficiency, quantitative flux or a stable complex. Owner CHEBI:7025 denotes PA-A, not the clinical mixture; other source-assigned metabolites remain distinct. Not full-record sign-off.
| Subject | Predicate | Object | Notes | Evidence |
|---|---|---|---|---|
| NCIMB 10586 reference mupirocin locus | encodes_native_reference_example | MupC native sequence example (NCIMB 10586) | AF318063.3 CDS 40523..41818(+), 1-based inclusive; AAM12914.1, 431 aa. Native deposit strain NCIMB 10586, taxon 294. CDS-aware table-11 translation exactly matches GenPept and UniProt; unreviewed sequence version 1. Deliberately selected gene-matched pathway reference, not confirmed identity with the historical experimental strain, intact protein or deletion allele. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| NCIMB 10586 reference mupirocin locus | encodes_native_reference_example | MupO native sequence example (NCIMB 10586) | AF318063.3 CDS 58574..59938(+), 1-based inclusive; AAM12929.2, 454 aa. Native deposit strain NCIMB 10586, taxon 294. CDS-aware table-11 translation exactly matches GenPept and UniProt; unreviewed sequence version 2. Deliberately selected gene-matched pathway reference, not confirmed identity with the historical experimental strain, intact protein or deletion allele. AAM12929.2 replaced version1 in 2014, after the cited experiment. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| NCIMB 10586 reference mupirocin locus | encodes_native_reference_example | MupU native sequence example (NCIMB 10586) | AF318063.3 CDS 66415..67992(+), 1-based inclusive; AAM12937.1, 525 aa. Native deposit strain NCIMB 10586, taxon 294. CDS-aware table-11 translation exactly matches GenPept and UniProt; unreviewed sequence version 1. Deliberately selected gene-matched pathway reference, not confirmed identity with the historical experimental strain, intact protein or deletion allele. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| NCIMB 10586 reference mupirocin locus | encodes_native_reference_example | MupV native sequence example (NCIMB 10586) | AF318063.3 CDS 68027..70015(+), 1-based inclusive; AAM12938.1, 662 aa. Native deposit strain NCIMB 10586, taxon 294. CDS-aware table-11 translation exactly matches GenPept and UniProt; unreviewed sequence version 1. Deliberately selected gene-matched pathway reference, not confirmed identity with the historical experimental strain, intact protein or deletion allele. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| NCIMB 10586 reference mupirocin locus | encodes_native_reference_example | MacpE native sequence example (NCIMB 10586) | AF318063.3 CDS 65730..65972(+), 1-based inclusive; AAM12935.1, 80 aa. Native deposit strain NCIMB 10586, taxon 294. CDS-aware table-11 translation exactly matches GenPept and UniProt; unreviewed sequence version 1. Deliberately selected gene-matched pathway reference, not confirmed identity with the historical experimental strain, intact protein or deletion allele. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| mupC in-frame deletion (mupC/mupO) | has_gene_matched_native_reference_example | MupC native sequence example (NCIMB 10586) | Locus-name correspondence only; no equality of stock sequences or retained intact protein asserted. | DOI:10.1074/jbc.M701490200
|
| mupC in-frame deletion (mupC/mupO) | was_present_in | Study P. fluorescens mupC/mupO double-mutant culture | Reported mutant context; deletion junctions and polar effects unverified. | DOI:10.1074/jbc.M701490200
|
| mupO in-frame deletion (mupC/mupO) | has_gene_matched_native_reference_example | MupO native sequence example (NCIMB 10586) | Locus-name correspondence only; no equality of stock sequences or retained intact protein asserted. | DOI:10.1074/jbc.M701490200
|
| mupO in-frame deletion (mupC/mupO) | was_present_in | Study P. fluorescens mupC/mupO double-mutant culture | Reported mutant context; deletion junctions and polar effects unverified. | DOI:10.1074/jbc.M701490200
|
| Study P. fluorescens mupC/mupO double-mutant culture | retained_reported_production_of | Source-assigned pseudomonic acid B | Bounded culture-product report. | DOI:10.1074/jbc.M701490200
|
| Study P. fluorescens mupC/mupO double-mutant culture | lacked_reported_production_of | Source-assigned pseudomonic acid A | Reported absence, not a measured zero or universal inability to produce PA-A. | DOI:10.1074/jbc.M701490200
|
| mupC in-frame deletion (mupC/mupU) | has_gene_matched_native_reference_example | MupC native sequence example (NCIMB 10586) | Locus-name correspondence only; no equality of stock sequences or retained intact protein asserted. | DOI:10.1074/jbc.M701490200
|
| mupC in-frame deletion (mupC/mupU) | was_present_in | Study P. fluorescens mupC/mupU double-mutant culture | Reported mutant context; deletion junctions and polar effects unverified. | DOI:10.1074/jbc.M701490200
|
| mupU in-frame deletion (mupC/mupU) | has_gene_matched_native_reference_example | MupU native sequence example (NCIMB 10586) | Locus-name correspondence only; no equality of stock sequences or retained intact protein asserted. | DOI:10.1074/jbc.M701490200
|
| mupU in-frame deletion (mupC/mupU) | was_present_in | Study P. fluorescens mupC/mupU double-mutant culture | Reported mutant context; deletion junctions and polar effects unverified. | DOI:10.1074/jbc.M701490200
|
| Study P. fluorescens mupC/mupU double-mutant culture | retained_reported_production_of | Source-assigned pseudomonic acid B | Bounded culture-product report. | DOI:10.1074/jbc.M701490200
|
| Study P. fluorescens mupC/mupU double-mutant culture | lacked_reported_production_of | Source-assigned pseudomonic acid A | Reported absence, not a measured zero or universal inability to produce PA-A. | DOI:10.1074/jbc.M701490200
|
| mupC in-frame deletion (mupC/mupV) | has_gene_matched_native_reference_example | MupC native sequence example (NCIMB 10586) | Locus-name correspondence only; no equality of stock sequences or retained intact protein asserted. | DOI:10.1074/jbc.M701490200
|
| mupC in-frame deletion (mupC/mupV) | was_present_in | Study P. fluorescens mupC/mupV double-mutant culture | Reported mutant context; deletion junctions and polar effects unverified. | DOI:10.1074/jbc.M701490200
|
| mupV in-frame deletion (mupC/mupV) | has_gene_matched_native_reference_example | MupV native sequence example (NCIMB 10586) | Locus-name correspondence only; no equality of stock sequences or retained intact protein asserted. | DOI:10.1074/jbc.M701490200
|
| mupV in-frame deletion (mupC/mupV) | was_present_in | Study P. fluorescens mupC/mupV double-mutant culture | Reported mutant context; deletion junctions and polar effects unverified. | DOI:10.1074/jbc.M701490200
|
| Study P. fluorescens mupC/mupV double-mutant culture | retained_reported_production_of | Source-assigned pseudomonic acid B | Bounded culture-product report. | DOI:10.1074/jbc.M701490200
|
| Study P. fluorescens mupC/mupV double-mutant culture | lacked_reported_production_of | Source-assigned pseudomonic acid A | Reported absence, not a measured zero or universal inability to produce PA-A. | DOI:10.1074/jbc.M701490200
|
| mupC in-frame deletion (mupC/macpE) | has_gene_matched_native_reference_example | MupC native sequence example (NCIMB 10586) | Locus-name correspondence only; no equality of stock sequences or retained intact protein asserted. | DOI:10.1074/jbc.M701490200
|
| mupC in-frame deletion (mupC/macpE) | was_present_in | Study P. fluorescens mupC/macpE double-mutant culture | Reported mutant context; deletion junctions and polar effects unverified. | DOI:10.1074/jbc.M701490200
|
| macpE in-frame deletion (mupC/macpE) | has_gene_matched_native_reference_example | MacpE native sequence example (NCIMB 10586) | Locus-name correspondence only; no equality of stock sequences or retained intact protein asserted. | DOI:10.1074/jbc.M701490200
|
| macpE in-frame deletion (mupC/macpE) | was_present_in | Study P. fluorescens mupC/macpE double-mutant culture | Reported mutant context; deletion junctions and polar effects unverified. | DOI:10.1074/jbc.M701490200
|
| Study P. fluorescens mupC/macpE double-mutant culture | retained_reported_production_of | Source-assigned pseudomonic acid B | Bounded culture-product report. | DOI:10.1074/jbc.M701490200
|
| Study P. fluorescens mupC/macpE double-mutant culture | lacked_reported_production_of | Source-assigned pseudomonic acid A | Reported absence, not a measured zero or universal inability to produce PA-A. | DOI:10.1074/jbc.M701490200
|
| MupO native sequence example (NCIMB 10586) | is_proposed_to_act_before | MupC native sequence example (NCIMB 10586) | Author pathway-order inference from mutant outcomes; no direct binding, chemical step or temporal measurement follows. MacpE is not silently added to this reported ordering. | DOI:10.1074/jbc.M701490200
|
| MupU native sequence example (NCIMB 10586) | is_proposed_to_act_before | MupC native sequence example (NCIMB 10586) | Author pathway-order inference from mutant outcomes; no direct binding, chemical step or temporal measurement follows. MacpE is not silently added to this reported ordering. | DOI:10.1074/jbc.M701490200
|
| MupV native sequence example (NCIMB 10586) | is_proposed_to_act_before | MupC native sequence example (NCIMB 10586) | Author pathway-order inference from mutant outcomes; no direct binding, chemical step or temporal measurement follows. MacpE is not silently added to this reported ordering. | DOI:10.1074/jbc.M701490200
|
Every edge carries its own citation; an uncited edge is refused by the corpus tests.
Causal graph — biosynthesis 13 nodes, 15 edges
Reported paired cotranscription and proposed methyl-addition participants. Native examples, unverified study gene products and gene loci remain distinct. Only the primary 2007 abstract was inspected; it names P. fluorescens but not strain. Full text, figures and SI unread. No purified chemistry, stable complex, complete stock or direct PA-A formation assay asserted. CHEBI:7025 is the PA-A owner, not the clinical mixture. No full-record sign-off.
| Subject | Predicate | Object | Notes | Evidence |
|---|---|---|---|---|
| NCIMB 10586 reference mupirocin locus | encodes_native_reference_example | MupH native sequence example (NCIMB 10586) | AF318063.3 CDS 46964..48229(+), 1-based inclusive; AAM12922.1, 421 aa. CDS-aware table-11 translation exactly matches GenPept and current UniProt; unreviewed sequence version 1, NCIMB 10586, taxon 294. Deliberately selected gene-matched reference, not confirmed historical experimental stock. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| Study MupH gene product (sequence unverified) | has_gene_matched_native_reference_example | MupH native sequence example (NCIMB 10586) | Gene-name/pathway correspondence; not evidence of sequence equality, assay construct or historical strain. | DOI:10.1074/jbc.M701490200
|
| Study MupH gene product (sequence unverified) | is_proposed_to_participate_in | Proposed methyl-addition role in the mupirocin pathway | The abstract implicates these gene products in methyl addition. No direct enzyme assay, substrate identity, carbon numbering, dehydration or decarboxylation step is adopted. | DOI:10.1074/jbc.M701490200
|
| NCIMB 10586 reference mupirocin locus | encodes_native_reference_example | MupJ native sequence example (NCIMB 10586) | AF318063.3 CDS 48226..48993(+), 1-based inclusive; AAM12923.1, 255 aa. CDS-aware table-11 translation exactly matches GenPept and current UniProt; unreviewed sequence version 1, NCIMB 10586, taxon 294. Deliberately selected gene-matched reference, not confirmed historical experimental stock. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| Study MupJ gene product (sequence unverified) | has_gene_matched_native_reference_example | MupJ native sequence example (NCIMB 10586) | Gene-name/pathway correspondence; not evidence of sequence equality, assay construct or historical strain. | DOI:10.1074/jbc.M701490200
|
| Study MupJ gene product (sequence unverified) | is_proposed_to_participate_in | Proposed methyl-addition role in the mupirocin pathway | The abstract implicates these gene products in methyl addition. No direct enzyme assay, substrate identity, carbon numbering, dehydration or decarboxylation step is adopted. | DOI:10.1074/jbc.M701490200
|
| Study mupJ locus (allele unverified) | encodes_named_study_gene_product | Study MupJ gene product (sequence unverified) | Locus-to-gene-product correspondence only; not a sequence-resolved allele or expression measurement. | DOI:10.1074/jbc.M701490200
|
| Study mupJ locus (allele unverified) | is_member_of_reported_cotranscription_pair | Study mupJ/mupK paired cotranscription | The source reports a paired cotranscription requirement; no promoter sequence or experimental construct adopted. | DOI:10.1074/jbc.M701490200
|
| NCIMB 10586 reference mupirocin locus | encodes_native_reference_example | MupK native sequence example (NCIMB 10586) | AF318063.3 CDS 49047..49790(+), 1-based inclusive; AAM12924.1, 247 aa. CDS-aware table-11 translation exactly matches GenPept and current UniProt; unreviewed sequence version 1, NCIMB 10586, taxon 294. Deliberately selected gene-matched reference, not confirmed historical experimental stock. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| Study MupK gene product (sequence unverified) | has_gene_matched_native_reference_example | MupK native sequence example (NCIMB 10586) | Gene-name/pathway correspondence; not evidence of sequence equality, assay construct or historical strain. | DOI:10.1074/jbc.M701490200
|
| Study MupK gene product (sequence unverified) | is_proposed_to_participate_in | Proposed methyl-addition role in the mupirocin pathway | The abstract implicates these gene products in methyl addition. No direct enzyme assay, substrate identity, carbon numbering, dehydration or decarboxylation step is adopted. | DOI:10.1074/jbc.M701490200
|
| Study mupK locus (allele unverified) | encodes_named_study_gene_product | Study MupK gene product (sequence unverified) | Locus-to-gene-product correspondence only; not a sequence-resolved allele or expression measurement. | DOI:10.1074/jbc.M701490200
|
| Study mupK locus (allele unverified) | is_member_of_reported_cotranscription_pair | Study mupJ/mupK paired cotranscription | The source reports a paired cotranscription requirement; no promoter sequence or experimental construct adopted. | DOI:10.1074/jbc.M701490200
|
| Study mupJ/mupK paired cotranscription | was_reported_required_for | Reported normal function of the mupJ/mupK pair | Abstract-level genetic expression requirement. No quantitative yield, assay endpoint or exact stock is specified here. | DOI:10.1074/jbc.M701490200
|
| Study mupJ/mupK paired cotranscription | supports_proposed_cotranslational_coassembly | Author-proposed cotranslational coassembly | Author inference from the paired expression requirement, not measured physical binding, a stable complex or stoichiometry. | DOI:10.1074/jbc.M701490200
|
Every edge carries its own citation; an uncited edge is refused by the corpus tests.
Causal graph — biosynthesis 8 nodes, 8 edges
MupR/MupI regulatory gene deletion observations, bounded to the inspected 2001 primary abstract. Native reference proteins and engineered alleles remain distinct. No direct DNA binding, purified signal synthesis, exact signal identity or complete regulatory circuit is asserted. CHEBI:7025 denotes PA-A; the source's unresolved mupirocin readout is not silently recast as congener-specific PA-A production. Main text, figures and SI unread; no full-record sign-off.
| Subject | Predicate | Object | Notes | Evidence |
|---|---|---|---|---|
| Native NCIMB 10586 mupirocin locus | encodes_native_reference | Native MupR sequence reference | AF318063.3 CDS 71638..72342(+), 1-based inclusive; AAK28504.1, 234 aa. CDS-aware table-11 translation matches independently retrieved GenPept and current UniProt, unreviewed sequence version 1, taxon 294, native deposit strain NCIMB 10586. Native reference, not a complete deletion stock or retained intact protein in that stock. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| Study mupR deletion (junctions unverified) | affects_coding_locus_of | Native MupR sequence reference | Gene-name correspondence to the native coding locus; not a claim of intact protein expression in the deletion strain. | DOI:10.1099/00221287-147-8-2127
|
| Study mupR deletion (junctions unverified) | was_present_in | Study NCIMB 10586 mupR deletion culture | The abstract reports deletion inactivation using a suicide-vector strategy. No in-frame status or exact residual sequence inferred. | DOI:10.1099/00221287-147-8-2127
|
| Study NCIMB 10586 mupR deletion culture | was_reported_defective_for | Reported mupirocin biosynthesis (congeners unresolved) | Abstract-level requirement for the gene under the study conditions. Not a measured zero, a congener-specific PA-A yield or universal sufficiency claim. | DOI:10.1099/00221287-147-8-2127
|
| Native NCIMB 10586 mupirocin locus | encodes_native_reference | Native MupI sequence reference | AF318063.3 CDS 73911..74486(-), 1-based inclusive; AAK28505.1, 191 aa. CDS-aware table-11 translation matches independently retrieved GenPept and current UniProt, unreviewed sequence version 1, taxon 294, native deposit strain NCIMB 10586. Native reference, not a complete deletion stock or retained intact protein in that stock. | https://www.ncbi.nlm.nih.gov/nuccore/AF318063.3 |
| Study mupI deletion (junctions unverified) | affects_coding_locus_of | Native MupI sequence reference | Gene-name correspondence to the native coding locus; not a claim of intact protein expression in the deletion strain. | DOI:10.1099/00221287-147-8-2127
|
| Study mupI deletion (junctions unverified) | was_present_in | Study NCIMB 10586 mupI deletion culture | The abstract reports deletion inactivation using a suicide-vector strategy. No in-frame status or exact residual sequence inferred. | DOI:10.1099/00221287-147-8-2127
|
| Study NCIMB 10586 mupI deletion culture | was_reported_defective_for | Reported mupirocin biosynthesis (congeners unresolved) | Abstract-level requirement for the gene under the study conditions. Not a measured zero, a congener-specific PA-A yield or universal sufficiency claim. | DOI:10.1099/00221287-147-8-2127
|
Every edge carries its own citation; an uncited edge is refused by the corpus tests.
Elsewhere in the fleet
- AntibioticMech — CHEBI:7025 (same structure, same inchikey)
Explore across X-Mech
AntibioticMech (mupirocin) ↗
MediaIngredientMech (CHEBI:7025) ↗
TaxonMech: Pseudomonas fluorescens (NCBITaxon:294) ↗
PathwayMech (mibig:BGC0000182) ↗
Open questions 1
name-disagreement — ChEBI calls this structure 'mupirocin' and MIBiG calls it 'pseudomonic acid A'. They share a Standard InChIKey, so if the names denote different compounds then one upstream record has the wrong structure. Check which.
Provenance
| Source concept | Source | Version |
|---|---|---|
| BGC0000182 | MIBIG | 5 |
| CHEBI:7025 | CHEBI | 3-star |
This page is generated from data/natural_products/polyketides/mupirocin.yaml, which is generated from the committed inventories. Neither is edited by hand.